Protein:KAT5 |
Protein Summary |
 Gene summary |
| Gene name: KAT5 | ASpdb.0 ID: 10524 | Gene | Gene symbol | KAT5 | Gene ID | 10524 |
| Gene name | lysine acetyltransferase 5 |
| Synonyms | ESA1|HTATIP|HTATIP1|NEDFASB|PLIP|TIP|TIP60|ZC2HC5|cPLA2 |
| Cytomap | 11q13.1 |
| Type of gene | protein-coding |
| Description | histone acetyltransferase KAT560 kDa Tat-interactive proteinHIV-1 Tat interactive protein, 60kDaK(lysine) acetyltransferase 5K-acetyltransferase 5Tat interacting protein, 60kDacPLA(2)-interacting proteincPLA2 interacting proteinhistone acetyltrans |
| Modification date | 20240411 |
| UniProtAcc | Q92993 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | KAT5 | GO:0000132 | establishment of mitotic spindle orientation | 34608293 |
| Gene | KAT5 | GO:0000724 | double-strand break repair via homologous recombination | 27153538 |
| Gene | KAT5 | GO:0000776 | kinetochore | 26829474 |
| Gene | KAT5 | GO:0000785 | chromatin | 29335245|33076429 |
| Gene | KAT5 | GO:0000786 | nucleosome | 27153538 |
| Gene | KAT5 | GO:0000812 | Swr1 complex | 24463511 |
| Gene | KAT5 | GO:0003682 | chromatin binding | 29335245|33076429 |
| Gene | KAT5 | GO:0003713 | transcription coactivator activity | 14966270 |
| Gene | KAT5 | GO:0004402 | histone acetyltransferase activity | 18397884|25301942|29335245 |
| Gene | KAT5 | GO:0005515 | protein binding | 32832608 |
| Gene | KAT5 | GO:0005634 | nucleus | 17996965|24012345|25301942 |
| Gene | KAT5 | GO:0005654 | nucleoplasm | - |
| Gene | KAT5 | GO:0005730 | nucleolus | 16387653 |
| Gene | KAT5 | GO:0005737 | cytoplasm | 25301942 |
| Gene | KAT5 | GO:0005829 | cytosol | - |
| Gene | KAT5 | GO:0006289 | nucleotide-excision repair | 32034146 |
| Gene | KAT5 | GO:0006302 | double-strand break repair | 26438602 |
| Gene | KAT5 | GO:0006974 | DNA damage response | 33076429 |
| Gene | KAT5 | GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | 14966270 |
| Gene | KAT5 | GO:0010212 | response to ionizing radiation | 18397884 |
| Gene | KAT5 | GO:0010485 | histone H4 acetyltransferase activity | 10966108 |
| Gene | KAT5 | GO:0010508 | positive regulation of autophagy | 30704899 |
| Gene | KAT5 | GO:0010867 | positive regulation of triglyceride biosynthetic process | 29765047 |
| Gene | KAT5 | GO:0018394 | peptidyl-lysine acetylation | 30704899 |
| Gene | KAT5 | GO:0032703 | negative regulation of interleukin-2 production | 17360565 |
| Gene | KAT5 | GO:0032777 | piccolo histone acetyltransferase complex | 14966270 |
| Gene | KAT5 | GO:0035267 | NuA4 histone acetyltransferase complex | 10966108|14966270|27153538 |
| Gene | KAT5 | GO:0035861 | site of double-strand break | 27153538 |
| Gene | KAT5 | GO:0042149 | cellular response to glucose starvation | 34077757 |
| Gene | KAT5 | GO:0043231 | intracellular membrane-bounded organelle | - |
| Gene | KAT5 | GO:0043998 | histone H2A acetyltransferase activity | 10966108|27153538 |
| Gene | KAT5 | GO:0043999 | histone H2AK5 acetyltransferase activity | 26438602 |
| Gene | KAT5 | GO:0045591 | positive regulation of regulatory T cell differentiation | 24835996 |
| Gene | KAT5 | GO:0045663 | positive regulation of myoblast differentiation | 26291311 |
| Gene | KAT5 | GO:0045892 | negative regulation of DNA-templated transcription | 17360565 |
| Gene | KAT5 | GO:0045893 | positive regulation of DNA-templated transcription | 14966270 |
| Gene | KAT5 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 29335245|33076429 |
| Gene | KAT5 | GO:0046972 | histone H4K16 acetyltransferase activity | 33076429 |
| Gene | KAT5 | GO:0061733 | peptide-lysine-N-acetyltransferase activity | 17189187|24835996|25301942|26291311|26829474|29765047|30409912|30704899|31857589|32034146|32817552|34077757 |
| Gene | KAT5 | GO:0062033 | positive regulation of mitotic sister chromatid segregation | 26829474 |
| Gene | KAT5 | GO:0071392 | cellular response to estradiol stimulus | 23637611 |
| Gene | KAT5 | GO:0097431 | mitotic spindle pole | 34608293 |
| Gene | KAT5 | GO:0140064 | peptide crotonyltransferase activity | 34608293 |
| Gene | KAT5 | GO:0140065 | peptide butyryltransferase activity | 29192674 |
| Gene | KAT5 | GO:0140861 | DNA repair-dependent chromatin remodeling | 25301942 |
| Gene | KAT5 | GO:1901985 | positive regulation of protein acetylation | 24012345 |
| Gene | KAT5 | GO:1902425 | positive regulation of attachment of mitotic spindle microtubules to kinetochore | 30409912 |
| Gene | KAT5 | GO:1905168 | positive regulation of double-strand break repair via homologous recombination | 27153538|32832608 |
| Gene | KAT5 | GO:1905337 | positive regulation of aggrephagy | 31857589 |
| Gene | KAT5 | GO:1905691 | lipid droplet disassembly | 34077757 |
| Gene | KAT5 | GO:2000042 | negative regulation of double-strand break repair via homologous recombination | 32832608 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q92993-1 | Q92993-1_2ou2_A.pdb | 2OU2 | X-ray | 2.3 | A | 230 | 504 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q92993 | KAT5 | Q92993-1 | Q92993-2 | 513 | 461 | 96 | 147 | Deletion | none | none | 95 | 95 |
| Q92993 | KAT5 | Q92993-1 | Q92993-3 | 513 | 546 | 4 | 4 | Substitution | V | VVSPVPGAGRREPGEVGRARGPPVADPGVALSPQ | 4 | 37 |
| Q92993 | KAT5 | Q92993-1 | Q92993-4 | 513 | 494 | 4 | 4 | Substitution | V | VVSPVPGAGRREPGEVGRARGPPVADPGVALSPQ | 4 | 37 |
| Q92993 | KAT5 | Q92993-1 | Q92993-4 | 513 | 494 | 96 | 147 | Deletion | none | none | 128 | 128 |
| Multiple sequence alignment of our canonical and alternatively spliced KAT5 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of KAT5 |
| UniProt-id | ENSG | ENST | ENSP |
| Q92993-1 | ENSG00000172977.13 | ENST00000377046.7 | ENSP00000366245.3 |
| Q92993-2 | ENSG00000172977.13 | ENST00000352980.8 | ENSP00000344955.4 |
| Q92993-3 | ENSG00000172977.13 | ENST00000341318.9 | ENSP00000340330.4 |
| Q92993-4 | ENSG00000172977.13 | ENST00000530446.5 | ENSP00000434765.1 |
| UniProt-id | NM ID | NP ID |
| Q92993-1 | NM_006388.3 | NP_006379.2 |
| Q92993-2 | NM_182709.2 | NP_874368.1 |
| Q92993-3 | NM_182710.2 | NP_874369.1 |
| Q92993-4 | NM_001206833.1 | NP_001193762.1 |
| Amino acid sequences of our canonical and alternatively spliced KAT5 |
| accession_id | Protein sequence |
| Q92993-1 | MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGS PEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYG RSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSI |
| Q92993-2 | MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGS PEREVKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNI ECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKC FLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL SYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHF |
| Q92993-3 | MAEVVSPVPGAGRREPGEVGRARGPPVADPGVALSPQGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEW VTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST KRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIEL GRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSY WSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDW |
| Q92993-4 | MAEVVSPVPGAGRREPGEVGRARGPPVADPGVALSPQGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEW VTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDS QDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPP GNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRR GYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYK |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| KAT5 (go to UniProt):Q92993 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q92993 | Region | 69 | 106 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=96;End=147 |
| Q92993 | Region | 69 | 106 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=96;End=147 |
| Q92993 | Region | 122 | 220 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=96;End=147 |
| Q92993 | Region | 122 | 220 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=96;End=147 |
Gene Isoform Structures and Expression Levels for KAT5 |
| Gene structures of our canonical and alternative spliced genes of KAT5 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q92993-1 |
| 3D view using mol* of Q92993-2 |
| 3D view using mol* of Q92993-3 |
| 3D view using mol* of Q92993-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q92993-1 |
 |
| pLDDT distribution across the protein length of Q92993-2 |
 |
| pLDDT distribution across the protein length of Q92993-3 |
 |
| pLDDT distribution across the protein length of Q92993-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q92993-1 |
 |
| Ramachandran plot of Q92993-3 |
 |
| Ramachandran plot of Q92993-4 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q92993-1 | 1.026 | 106 | 1.014 | 189.679 | 0.478 | 0.738 | 1.028 | 0.508 | 1.13 | 0.45 | 0.674 | 303,337,339,357,358,359,360,361,364,365,366,389,39 2,393,396,398,399,400,502,504,505,506,507,508 |
| Q92993-2 | 1.031 | 105 | 0.999 | 190.365 | 0.488 | 0.744 | 1.023 | 0.422 | 1.189 | 0.355 | 0.81 | 285,287,305,306,307,308,309,312,313,314,340,341,34 4,346,347,348,450,452,453,454,455,456 |
| Q92993-3 | 1.029 | 489 | 1.007 | 1049.58 | 0.512 | 0.741 | 0.945 | 0.464 | 1.158 | 0.401 | 0.579 | 65,84,85,86,243,244,246,247,248,249,250,251,252,25 6,257,260,261,262,263,278,279,280,350,354,356,357, 358,359,360,361,362,363,369,371,389,400,401,402,40 3,404,405,409,410,411,412,413,414,415,416,417,418, 419,420,435,436,437,438,439,440,441,442,443,446,44 8,449,452,453,456,494,495,513,516,517,520,523,524, 525,526,527 |
| Q92993-4 | 1.014 | 545 | 0.972 | 1313.69 | 0.498 | 0.72 | 0.949 | 0.361 | 1.225 | 0.295 | 0.558 | 65,79,81,82,83,84,85,86,88,191,192,193,194,195,196 ,197,198,199,200,201,205,206,208,209,226,227,228,2 98,302,304,305,306,307,308,309,310,317,319,337,339 ,342,343,344,348,349,350,351,352,353,357,358,359,3 60,361,362,363,364,365,366,367,368,384,386,387,388 ,389,390,391,393,394,401,468,471,472,473,474,475 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q92993-1_Q92993-1_2ou2_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92993-1_2ou2_A_Q92993-2.pdb |
| 3D view using mol* of Q92993-1_2ou2_A_Q92993-3.pdb |
| 3D view using mol* of Q92993-1_2ou2_A_Q92993-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92993-1_Q92993-2.pdb |
| 3D view using mol* of Q92993-1_Q92993-3.pdb |
| 3D view using mol* of Q92993-1_Q92993-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q92993-1_vs_Q92993-2.png |
 < |
| ./stats/secondary_structure/figure/Q92993-1_vs_Q92993-3.png |
 < |
| ./stats/secondary_structure/figure/Q92993-1_vs_Q92993-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q92993-1_vs_Q92993-2.png |
 < |
| ./stats/relative_asa/Q92993-1_vs_Q92993-3.png |
 < |
| ./stats/relative_asa/Q92993-1_vs_Q92993-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to KAT5 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| Q92993 | KAT5 | DB02039 | S-Acetyl-Cysteine | experimental | |
| Q92993 | KAT5 | DB01992 | Coenzyme A | investigational, nutraceutical |
Related Diseases to KAT5 |
| Previous studies relating to the alternative splicing of KAT5 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| KAT5 | 25245946 | Two ZNF509 (ZBTB49) isoforms induce cell-cycle arrest by activating transcription of p21/CDKN1A and RB upon exposure to genotoxic stress. | ZNF509 is unique among POK family proteins in that four isoforms are generated by alternative splicing. Short ZNF509 (ZNF509S1, -S2 and -S3) isoforms contain one or two out of the seven zinc-fingers contained in long ZNF509 (ZNF509L). Here, we investigated the functions of ZNF509 isoforms in response to DNA damage, showing isoforms to be induced by p53. Intriguingly, to inhibit proliferation of HCT116 and HEK293 cells, we found that ZNF509L activates p21/CDKN1A transcription, while ZNF509S1 induces RB. ZNF509L binds to the p21/CDKN1A promoter either alone or by interacting with MIZ-1 to recruit the co-activator p300 to activate p21/CDKN1A transcription. In contrast, ZNF509S1 binds to the distal RB promoter to interact and interfere with the MIZF repressor, resulting in derepression and transcription of RB. Immunohistochemical analysis revealed that ZNF509 is highly expressed in normal epithelial cells, but was completely repressed in tumor tissues of the colon, lung and skin, indicating a possible role as a tumor suppressor. | D009369 | Neoplasms |
Clinically important variants in KAT5 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |