ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:CAMKK2

Protein Summary

Gene summary

Gene name: CAMKK2
ASpdb.0 ID: 10645
	Gene
Gene symbol	CAMKK2
Gene ID	10645
Gene name	calcium/calmodulin dependent protein kinase kinase 2
Synonyms	CAMKK\|CAMKKB
Cytomap	12q24.31
Type of gene	protein-coding
Description	calcium/calmodulin-dependent protein kinase kinase 2CAMKK beta proteincaM-KK 2caM-KK betacaM-kinase kinase 2caM-kinase kinase betacalcium/calmodulin-dependent protein kinase betacalcium/calmodulin-dependent protein kinase kinase 2, beta
Modification date	20240403
UniProtAcc	Q96RR4

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	CAMKK2	GO:0005509	calcium ion binding	11395482
Gene	CAMKK2	GO:0005829	cytosol	-
Gene	CAMKK2	GO:0006468	protein phosphorylation	11395482
Gene	CAMKK2	GO:0046777	protein autophosphorylation	11395482

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
Q96RR4-1	Q96RR4-1_6cmj_A.pdb	6CMJ	X-ray	2.4	A	161	463

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-2	588	533	533	533	Substitution	E	T	533	533
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-2	588	533	534	554	Deletion	none	none	533	533
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-2	588	533	555	588	Deletion	none	none	533	533
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-3	588	541	520	532	Substitution	KPTRECESLSELK	QGSEDNLQGTDPP	520	532
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-3	588	541	533	541	Substitution	EARQRRQPP	PVGEEEVLL	533	541
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-3	588	541	542	554	Deletion	none	none	541	541
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-3	588	541	555	588	Deletion	none	none	541	541
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-4	588	545	442	484	Deletion	none	none	441	441
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-5	588	498	442	484	Deletion	none	none	441	441
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-5	588	498	520	532	Substitution	KPTRECESLSELK	QGSEDNLQGTDPP	477	489
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-5	588	498	533	541	Substitution	EARQRRQPP	PVGEEEVLL	490	498
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-5	588	498	542	554	Deletion	none	none	498	498
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-5	588	498	555	588	Deletion	none	none	498	498
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-6	588	490	442	484	Deletion	none	none	441	441
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-6	588	490	533	533	Substitution	E	T	490	490
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-6	588	490	534	554	Deletion	none	none	490	490
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-6	588	490	555	588	Deletion	none	none	490	490
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-7	588	556	533	554	Substitution	EARQRRQPPGHRPAPRGGGGSA	GTKKKKGLDSMTSTVAAGWLDRRV	533	556
Q96RR4	CAMKK2	Q96RR4-1	Q96RR4-7	588	556	555	588	Deletion	none	none	556	556

Multiple sequence alignment of our canonical and alternatively spliced CAMKK2

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CAMKK2

UniProt-id	ENSG	ENST	ENSP
Q96RR4-1	ENSG00000110931.19	ENST00000324774.9	ENSP00000312741.5
Q96RR4-1	ENSG00000110931.19	ENST00000402834.8	ENSP00000384591.4
Q96RR4-1	ENSG00000110931.19	ENST00000404169.8	ENSP00000384600.3
Q96RR4-1	ENSG00000110931.19	ENST00000652382.1	ENSP00000498824.1
Q96RR4-2	ENSG00000110931.19	ENST00000392473.2	ENSP00000376265.2
Q96RR4-3	ENSG00000110931.19	ENST00000337174.7	ENSP00000336634.3
Q96RR4-3	ENSG00000110931.19	ENST00000412367.6	ENSP00000388368.2
Q96RR4-4	ENSG00000110931.19	ENST00000347034.6	ENSP00000321230.3
Q96RR4-5	ENSG00000110931.19	ENST00000538733.5	ENSP00000445944.1
Q96RR4-6	ENSG00000110931.19	ENST00000446440.6	ENSP00000388273.2
Q96RR4-7	ENSG00000110931.19	ENST00000392474.6	ENSP00000376266.2

UniProt-id	NM ID	NP ID
Q96RR4-1	NM_001270485.1	NP_001257414.1
Q96RR4-1	NM_006549.3	NP_006540.3
Q96RR4-2	NM_172214.2	NP_757363.1
Q96RR4-2	XM_005253823.1	XP_005253880.1
Q96RR4-3	NM_153499.2	NP_705719.2
Q96RR4-3	NM_172226.2	NP_757380.1
Q96RR4-4	NM_172216.1	NP_757365.1
Q96RR4-4	XM_005253822.3	XP_005253879.1
Q96RR4-5	NM_153500.1	NP_705720.1
Q96RR4-5	XM_005253824.3	XP_005253881.1
Q96RR4-6	NM_172215.2	NP_757364.1
Q96RR4-7	NM_001270486.1	NP_001257415.1
Q96RR4-7	XM_011537763.1	XP_011536065.1
Q96RR4-7	XM_017018702.1	XP_016874191.1

Amino acid sequences of our canonical and alternatively spliced CAMKK2

accession_id	Protein sequence
Q96RR4-1	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHG AEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
Q96RR4-2	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHG
Q96RR4-3	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHG AEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVL
Q96RR4-4	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKILVKTMIRK RSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQPPGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEE
Q96RR4-5	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKILVKTMIRK
Q96RR4-6	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKILVKTMIRK
Q96RR4-7	MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQA RPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELV NQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHG AEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKGTKKKKGL

Protein Functional Features

Main function of this protein. (from UniProt)

CAMKK2 (go to UniProt):Q96RR4

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q96RR4	Domain	165	446	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=442;End=484
Q96RR4	Domain	165	446	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=442;End=484
Q96RR4	Domain	165	446	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=442;End=484
Q96RR4	Region	472	477	Note=Autoinhibitory domain;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	472	477	Note=Autoinhibitory domain;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	472	477	Note=Autoinhibitory domain;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	475	500	Note=Calmodulin-binding;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	475	500	Note=Calmodulin-binding;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	475	500	Note=Calmodulin-binding;Ontology_term=ECO:0000250;evidence=ECO:0000250	Type=Deletion;Start=442;End=484
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=533
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=534;End=554
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=555;End=588
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=520;End=532
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=541
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=542;End=554
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=555;End=588
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=520;End=532
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=541
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=542;End=554
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=555;End=588
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=533
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=534;End=554
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=555;End=588
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=554
Q96RR4	Region	497	588	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=555;End=588
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=533
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=534;End=554
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=520;End=532
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=541
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=520;End=532
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=541
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=533
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=534;End=554
Q96RR4	Compositional bias	523	540	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=533;End=554

Gene Isoform Structures and Expression Levels for CAMKK2

Gene structures of our canonical and alternative spliced genes of CAMKK2
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of Q96RR4-1

3D view using mol* of Q96RR4-2

3D view using mol* of Q96RR4-3

3D view using mol* of Q96RR4-4

3D view using mol* of Q96RR4-5

3D view using mol* of Q96RR4-6

3D view using mol* of Q96RR4-7

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of Q96RR4-1

pLDDT distribution across the protein length of Q96RR4-2

pLDDT distribution across the protein length of Q96RR4-3

pLDDT distribution across the protein length of Q96RR4-4

pLDDT distribution across the protein length of Q96RR4-5

pLDDT distribution across the protein length of Q96RR4-6

pLDDT distribution across the protein length of Q96RR4-7

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of Q96RR4-1

Ramachandran plot of Q96RR4-2

Ramachandran plot of Q96RR4-5

Ramachandran plot of Q96RR4-6

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
Q96RR4-1	1.14	215	1.176	351.918	0.356	0.85	1.122	1.905	0.842	2.263	0.735	49,50,51,53,54,55,56,58,169,170,171,172,173,174,17 5,176,177,178,179,181,192,194,196,233,236,240,249, 250,267,268,269,270,271,273,274,310,312,314,316,31 7,319,327,329,330,331,332,333,334,350
Q96RR4-2	1.146	226	1.182	410.228	0.394	0.858	1.121	1.736	0.835	2.079	0.854	48,49,50,51,53,54,55,56,58,169,170,171,172,173,174 ,175,176,177,178,179,181,192,194,196,232,236,240,2 49,250,267,268,269,270,271,273,274,310,312,314,316 ,317,319,329,330,331,332,333,334
Q96RR4-3	1.131	163	1.198	348.488	0.486	0.777	0.965	1.84	0.637	2.887	0.984	51,53,54,55,56,57,58,169,170,171,172,173,174,175,1 76,177,179,181,192,194,196,236,240,249,267,269,270 ,271,272,273,274,276,277,319,329,330,331
Q96RR4-4	1.028	503	1.063	1410.759	0.604	0.705	0.891	0.744	0.92	0.808	0.947	43,44,45,46,47,48,49,50,51,52,53,54,55,56,58,169,1 70,171,172,173,174,175,176,177,178,179,181,192,194 ,196,201,202,204,205,206,207,208,223,224,225,226,2 27,228,229,232,233,235,236,238,239,240,249,250,267 ,268,269,270,271,273,274,277,278,279,311,312,314,3 15,316,319,327,329,330,331,332,333,334,335,336,337 ,338,341,342,343,344,345,346,347,348,349,350,351,3 52,353,354,357,360,361,362,363,364,366,387,388,391 ,392,393,394,395,398
Q96RR4-5	1.179	161	1.23	318.647	0.383	0.873	1.147	2.215	0.717	3.09	1.144	49,51,52,53,55,56,58,169,171,172,173,174,175,176,1 77,178,179,181,190,192,194,236,240,249,267,269,270 ,271,273,274,312,314,317,319,329,330,331,332,333
Q96RR4-6	1.035	448	1.06	1284.878	0.57	0.733	0.937	0.904	0.981	0.921	0.996	45,46,47,48,49,50,51,52,53,54,55,56,58,169,171,172 ,173,174,175,176,177,179,181,192,194,196,201,202,2 03,204,205,206,207,208,221,222,223,224,226,227,228 ,229,232,233,235,236,240,249,250,267,268,269,270,2 71,273,274,277,278,311,312,314,315,316,317,319,329 ,330,331,332,333,334,335,336,337,338,341,342,343,3 44,345,346,347,348,349,350,351,352,353,354,358,360 ,362,363,364,366,391,392,393,394,395,398,399
Q96RR4-7	1.127	148	1.195	315.56	0.505	0.772	1.012	1.932	0.638	3.027	1.206	51,53,54,55,56,58,169,170,171,172,173,174,176,177, 179,181,192,194,196,236,240,249,250,267,268,269,27 0,271,273,274,319,329,330,331,332

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of Q96RR4-1_Q96RR4-1_6cmj_A.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-2.pdb

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-3.pdb

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-4.pdb

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-5.pdb

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-6.pdb

3D view using mol* of Q96RR4-1_6cmj_A_Q96RR4-7.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q96RR4-1_Q96RR4-2.pdb

3D view using mol* of Q96RR4-1_Q96RR4-3.pdb

3D view using mol* of Q96RR4-1_Q96RR4-4.pdb

3D view using mol* of Q96RR4-1_Q96RR4-5.pdb

3D view using mol* of Q96RR4-1_Q96RR4-6.pdb

3D view using mol* of Q96RR4-1_Q96RR4-7.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-2.png

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-3.png

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-4.png

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-5.png

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-6.png

./stats/secondary_structure/figure/Q96RR4-1_vs_Q96RR4-7.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-2.png

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-3.png

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-4.png

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-5.png

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-6.png

./stats/relative_asa/Q96RR4-1_vs_Q96RR4-7.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id

Subsection

Start

End

Funcitonal feature

Splicing information

Interactors from STRING.

Gene name

Interactors

Related Drugs to CAMKK2

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession	Gene name	DrugBank ID	Drug name	Drug group	Actions
Q96RR4	CAMKK2	DB12010	Fostamatinib	approved, investigational	inhibitor

Related Diseases to CAMKK2

Previous studies relating to the alternative splicing of CAMKK2 and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
CAMKK2	9662074	Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase.	A human cDNA clone encoding the calcium/calmodulin-dependent protein kinase kinase (CaMKK) was isolated by RT-PCR amplification of the fragment corresponding to the conserved kinase catalytic domain followed by rapid amplification of cDNA ends and cDNA library screening. Compilation of nucleotide sequencing data yielded a consensus cDNA sequence of 1.9 kb with an open reading frame of 1,251 nucleotides in length which translates to a polypeptide of 417 amino acids (47 kd). It showed significant homology to the rat brain CaMKK isozymes. The human CaMKK, which was expressed as a Flag-tagged protein in human non-small cell lung cancer H- 1299 cells followed by immunoprecipitation with anti-Flag antibody, was shown to phosphorylate recombinant human CaMK I in a calcium/CaM-dependent fashion. Northern blot analysis revealed that human CaMKK is ubiquitously expressed, with brain showing the highest level of expression. The CaMKK gene is localized to human chromosome 12. The presence of cDNA clones with divergent 3' terminal sequences suggests a family of CaMKK variants which may arise from alternative splicing.	D002289	Carcinoma, Non-Small-Cell Lung
CAMKK2	9662074	Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase.	A human cDNA clone encoding the calcium/calmodulin-dependent protein kinase kinase (CaMKK) was isolated by RT-PCR amplification of the fragment corresponding to the conserved kinase catalytic domain followed by rapid amplification of cDNA ends and cDNA library screening. Compilation of nucleotide sequencing data yielded a consensus cDNA sequence of 1.9 kb with an open reading frame of 1,251 nucleotides in length which translates to a polypeptide of 417 amino acids (47 kd). It showed significant homology to the rat brain CaMKK isozymes. The human CaMKK, which was expressed as a Flag-tagged protein in human non-small cell lung cancer H- 1299 cells followed by immunoprecipitation with anti-Flag antibody, was shown to phosphorylate recombinant human CaMK I in a calcium/CaM-dependent fashion. Northern blot analysis revealed that human CaMKK is ubiquitously expressed, with brain showing the highest level of expression. The CaMKK gene is localized to human chromosome 12. The presence of cDNA clones with divergent 3' terminal sequences suggests a family of CaMKK variants which may arise from alternative splicing.	D008175	Lung Neoplasms
CAMKK2	21957496	Differential effects of PKA-controlled CaMKK2 variants on neuronal differentiation.	Regulation between protein kinases is critical for the establishment of signaling pathways/networks to 'orchestrate' cellular processes. Besides posttranslational phosphorylation, alternative pre-mRNA splicing is another way to control kinase properties, but splicing regulation between two kinases and the effect of resulting variants on cells has barely been explored. Here we examined the effect of the protein kinase A (PKA) pathway on the alternative splicing and variant properties of the CaÂ²âº/calmodulin-dependent protein kinase kinase 2 (CaMKK2) gene in B35 neuroblastoma cells. Inclusion of the exon 16 of CaMKK2 was significantly reduced by H89, a PKA selective inhibitor. Consistently, overexpressed PKA strongly promoted the exon inclusion in a CaMKK2 sequence-dependent way in splicing reporter assays. In vitro, purified CaMKKÎ²1 variant proteins were found to be kinase-active. In cells, they were differentially phosphorylated by PKA. In RNA interference assays, CaMKKÎ²1 was found to be essential for forskolin-induced neurite growth. Interestingly, overexpression of the variant without exon 16 (-E16) promoted neurite elongation while the other one (+E16) promoted neurite branching; in contrast, reduction of the latter one enhanced neurite elongation. Moreover, the variants are differentially expressed and the exon 16-containing transcripts highly enriched in the brain, particularly the cerebellum and hippocampus. Thus, PKA regulates the alternative splicing of CaMKK2 to produce variants that differentially modulate neuronal differentiation. Taken together with the many distinct variants of kinases, alternative splicing regulation likely adds another layer of modulation between protein kinases in cellular signaling networks.	D009447	Neuroblastoma

Clinically important variants in CAMKK2

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance