Protein:OGA |
Protein Summary |
 Gene summary |
| Gene name: OGA | ASpdb.0 ID: 10724 | Gene | Gene symbol | OGA | Gene ID | 10724 |
| Gene name | O-GlcNAcase |
| Synonyms | MEA5|MGEA5|NCOAT |
| Cytomap | 10q24.32 |
| Type of gene | protein-coding |
| Description | protein O-GlcNAcaseN-acetyl-beta-D-glucosaminidaseN-acetyl-beta-glucosaminidasebeta-N-acetylglucosaminidasebeta-N-acetylhexosaminidasebeta-hexosaminidasebifunctional protein NCOAThyaluronidase in meningiomameningioma expressed antigen 5 (hyaluroni |
| Modification date | 20240407 |
| UniProtAcc | O60502 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | OGA | GO:0005829 | cytosol | 11148210 |
| Gene | OGA | GO:0006044 | N-acetylglucosamine metabolic process | 11148210 |
| Gene | OGA | GO:0006517 | protein deglycosylation | 11148210 |
| Gene | OGA | GO:0016231 | beta-N-acetylglucosaminidase activity | 11148210 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| O60502-1 | O60502-1_6hki_A.pdb | 6HKI | X-ray | 3.3 | A | 58 | 715 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| O60502 | OGA | O60502-1 | O60502-2 | 916 | 849 | 346 | 398 | Deletion | none | none | 345 | 345 |
| O60502 | OGA | O60502-1 | O60502-2 | 916 | 849 | 691 | 704 | Deletion | none | none | 637 | 637 |
| O60502 | OGA | O60502-1 | O60502-3 | 916 | 677 | 663 | 677 | Substitution | CRSHSSAQFLIGDQE | RCTRNNLFSSNILSL | 663 | 677 |
| O60502 | OGA | O60502-1 | O60502-3 | 916 | 677 | 678 | 916 | Deletion | none | none | 677 | 677 |
| O60502 | OGA | O60502-1 | O60502-4 | 916 | 863 | 346 | 398 | Deletion | none | none | 345 | 345 |
| Multiple sequence alignment of our canonical and alternatively spliced OGA |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of OGA |
| UniProt-id | ENSG | ENST | ENSP |
| O60502-1 | ENSG00000198408.14 | ENST00000361464.8 | ENSP00000354850.3 |
| O60502-2 | ENSG00000198408.14 | ENST00000357797.9 | ENSP00000350445.4 |
| O60502-3 | ENSG00000198408.14 | ENST00000370094.7 | ENSP00000359112.3 |
| O60502-4 | ENSG00000198408.14 | ENST00000439817.5 | ENSP00000409973.1 |
| UniProt-id | NM ID | NP ID |
| O60502-1 | NM_012215.3 | NP_036347.1 |
| O60502-4 | NM_001142434.1 | NP_001135906.1 |
| Amino acid sequences of our canonical and alternatively spliced OGA |
| accession_id | Protein sequence |
| O60502-1 | MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWEL NTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKI IKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTT LTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSN CANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVTPFIKKCKISWIPFMQEKYTKPNG DKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA |
| O60502-2 | MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWEL NTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKI IKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMSRQVAHSGAKASVVD GTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDK ESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVS VNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRG GLAGEFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVT PFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAF |
| O60502-3 | MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWEL NTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKI IKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTT LTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSN |
| O60502-4 | MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWEL NTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKI IKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMSRQVAHSGAKASVVD GTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDK ESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVS VNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRG GLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDE DGICGYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMAC |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| OGA (go to UniProt):O60502 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for OGA |
| Gene structures of our canonical and alternative spliced genes of OGA * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of O60502-1 |
| 3D view using mol* of O60502-2 |
| 3D view using mol* of O60502-3 |
| 3D view using mol* of O60502-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of O60502-1 |
 |
| pLDDT distribution across the protein length of O60502-2 |
 |
| pLDDT distribution across the protein length of O60502-3 |
 |
| pLDDT distribution across the protein length of O60502-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of O60502-1 |
 |
| Ramachandran plot of O60502-2 |
 |
| Ramachandran plot of O60502-3 |
 |
| Ramachandran plot of O60502-4 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| O60502-1 | 1.056 | 186 | 1.022 | 514.5 | 0.431 | 0.781 | 1.063 | 0.678 | 1.186 | 0.572 | 0.738 | 67,68,69,98,174,175,215,219,222,223,250,253,254,25 5,278,280,283,285,286,287,290,313,496,498,499,500, 501,568,569,678,679,680,681,682,684 |
| O60502-2 | 1.095 | 238 | 1.084 | 672.966 | 0.387 | 0.84 | 1.082 | 0.893 | 1.104 | 0.809 | 0.88 | 665,668,669,671,686,687,688,689,690,691,692,712,71 9,720,722,723,724,726,730,731,756,757,759,760,761, 762,763,764,766,769,775,777,778,779,811,812,813,81 4,817,819,820,824,839,842 |
| O60502-3 | 1.051 | 300 | 1.104 | 1256.409 | 0.648 | 0.702 | 0.865 | 0.988 | 0.788 | 1.253 | 1.008 | 69,70,71,72,73,74,75,76,77,78,95,97,100,101,102,11 1,115,118,119,122,284,285,288,289,290,291,292,316, 317,318,396,397,399,401,433,483,484,487,488,491,49 2,564,565,566,567,571,575,578,579,582,586,614,635, 638,639,641,642,643,646,647,650,651,653,654,657 |
| O60502-4 | 1.038 | 285 | 1.014 | 852.355 | 0.507 | 0.756 | 0.937 | 0.544 | 1.165 | 0.467 | 0.897 | 679,682,683,684,685,687,688,689,690,691,698,700,70 1,702,703,704,705,706,726,733,736,737,740,744,745, 763,766,767,770,771,775,776,778,783,789,791,792,79 3,796,824,825,826,827,828,830,831,832,833,834,838, 853,856 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of O60502-1_O60502-1_6hki_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O60502-1_6hki_A_O60502-2.pdb |
| 3D view using mol* of O60502-1_6hki_A_O60502-3.pdb |
| 3D view using mol* of O60502-1_6hki_A_O60502-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O60502-1_O60502-2.pdb |
| 3D view using mol* of O60502-1_O60502-3.pdb |
| 3D view using mol* of O60502-1_O60502-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/O60502-1_vs_O60502-2.png |
 < |
| ./stats/secondary_structure/figure/O60502-1_vs_O60502-3.png |
 < |
| ./stats/secondary_structure/figure/O60502-1_vs_O60502-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/O60502-1_vs_O60502-2.png |
 < |
| ./stats/relative_asa/O60502-1_vs_O60502-3.png |
 < |
| ./stats/relative_asa/O60502-1_vs_O60502-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to OGA |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to OGA |
| Previous studies relating to the alternative splicing of OGA and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| OGA | 9811929 | Novel immunogenic antigen homologous to hyaluronidase in meningioma. | By screening a meningioma expression library with autologous serum we identified four cDNA clones representing a novel gene with striking homology to Caenorhabditis elegans hyaluronidase as indicated by BLASTP analysis. In humans hyaluronidase has been implicated in cancer development and three human genes are known to encode proteins with hyaluronidase activity. None of the human genes, however, showed any homology at the nucleotide or amino acid sequence level to the newly isolated antigen we termed meningioma expressed antigen 5 (MGEA5). Somatic cell hybrid mapping and fluorescence in situ hybridization mapped the gene for MGEA5 to chromosomal band 10q24.1-q24.3. Reverse transcription (RT)-PCR and northern blot hybridization revealed expression of the gene encoding MGEA5 in several meningioma and additional human tissues. Expression analysis also indicated an alternative splicing event giving rise to a shorter and altered transcript termed MGEA5s. The expression of MGEA5 and MGEA5s as fusion proteins revealed an approximate molecular weight of 92 and 54 kDa, respectively. Using heterologous sera we found antibodies against MGEA5s in five out of 23 meningioma patients, whereas no immune reaction was detected in 12 control sera from healthy individuals. Confirmation of hyaluronidase activity was independently achieved by turbidometric analysis and a gel matrix assay. A model for involvement of the novel hyaluronidase gene in meningioma development is proposed. | D008579 | Meningioma |
Clinically important variants in OGA |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |