ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:KAT7

Protein Summary

Gene summary

Gene name: KAT7
ASpdb.0 ID: 11143
	Gene
Gene symbol	KAT7
Gene ID	11143
Gene name	lysine acetyltransferase 7
Synonyms	HBO1\|HBOA\|MYST2\|ZC2HC7
Cytomap	17q21.33
Type of gene	protein-coding
Description	histone acetyltransferase KAT7K(lysine) acetyltransferase 7MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2MYST histone acetyltransferase 2histone acetyltransferase MYST2histone acetyltransferase binding to ORC1
Modification date	20240411
UniProtAcc	O95251

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	KAT7	GO:0000123	histone acetyltransferase complex	16387653\|24065767\|26620551
Gene	KAT7	GO:0001558	regulation of cell growth	22144582
Gene	KAT7	GO:0004402	histone acetyltransferase activity	28719581
Gene	KAT7	GO:0005634	nucleus	21753189\|24065767\|24739512
Gene	KAT7	GO:0005654	nucleoplasm	16387653
Gene	KAT7	GO:0005694	chromosome	24065767
Gene	KAT7	GO:0005730	nucleolus	16387653
Gene	KAT7	GO:0005829	cytosol	-
Gene	KAT7	GO:0006275	regulation of DNA replication	16387653
Gene	KAT7	GO:0006355	regulation of DNA-templated transcription	22144582
Gene	KAT7	GO:0010485	histone H4 acetyltransferase activity	24065767
Gene	KAT7	GO:0018393	internal peptidyl-lysine acetylation	26221039
Gene	KAT7	GO:0030174	regulation of DNA-templated DNA replication initiation	26620551
Gene	KAT7	GO:0031098	stress-activated protein kinase signaling cascade	21856198
Gene	KAT7	GO:0036408	histone H3K14 acetyltransferase activity	16387653\|24065767\|26620551\|31827282
Gene	KAT7	GO:0036409	histone H3-K14 acetyltransferase complex	21753189
Gene	KAT7	GO:0043994	histone H3K23 acetyltransferase activity	24065767
Gene	KAT7	GO:0043995	histone H4K5 acetyltransferase activity	16387653
Gene	KAT7	GO:0043996	histone H4K8 acetyltransferase activity	16387653
Gene	KAT7	GO:0043997	histone H4K12 acetyltransferase activity	16387653
Gene	KAT7	GO:0045740	positive regulation of DNA replication	26620551
Gene	KAT7	GO:0046972	histone H4K16 acetyltransferase activity	16387653
Gene	KAT7	GO:0051726	regulation of cell cycle	16387653
Gene	KAT7	GO:0090734	site of DNA damage	28719581
Gene	KAT7	GO:0140889	DNA replication-dependent chromatin disassembly	16387653
Gene	KAT7	GO:1900182	positive regulation of protein localization to nucleus	24739512
Gene	KAT7	GO:1902035	positive regulation of hematopoietic stem cell proliferation	31827282
Gene	KAT7	GO:2000278	regulation of DNA biosynthetic process	16387653
Gene	KAT7	GO:2000819	regulation of nucleotide-excision repair	28719581

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
O95251-1	O95251-1_5gk9_A.pdb	5GK9	X-ray	2.4	A	336	608

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
O95251	KAT7	O95251-1	O95251-2	611	501	114	193	Deletion	none	none	113	113
O95251	KAT7	O95251-1	O95251-2	611	501	222	251	Deletion	none	none	141	141
O95251	KAT7	O95251-1	O95251-3	611	442	55	113	Deletion	none	none	54	54
O95251	KAT7	O95251-1	O95251-3	611	442	114	193	Deletion	none	none	54	54
O95251	KAT7	O95251-1	O95251-3	611	442	222	251	Deletion	none	none	82	82
O95251	KAT7	O95251-1	O95251-4	611	581	222	251	Deletion	none	none	221	221
O95251	KAT7	O95251-1	O95251-5	611	472	55	113	Deletion	none	none	54	54
O95251	KAT7	O95251-1	O95251-5	611	472	114	193	Deletion	none	none	54	54

Multiple sequence alignment of our canonical and alternatively spliced KAT7

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of KAT7

UniProt-id	ENSG	ENST	ENSP
O95251-1	ENSG00000136504.15	ENST00000259021.9	ENSP00000259021.4
O95251-2	ENSG00000136504.15	ENST00000509773.5	ENSP00000424577.1
O95251-3	ENSG00000136504.15	ENST00000510819.5	ENSP00000423385.1
O95251-4	ENSG00000136504.15	ENST00000424009.6	ENSP00000398961.2
O95251-4	ENSG00000136504.15	ENST00000706506.1	ENSP00000516419.1
O95251-5	ENSG00000136504.15	ENST00000454930.6	ENSP00000413415.2

UniProt-id	NM ID	NP ID
O95251-1	NM_007067.4	NP_008998.1
O95251-2	NM_001199157.1	NP_001186086.1
O95251-3	NM_001199158.1	NP_001186087.1
O95251-4	NM_001199155.1	NP_001186084.1
O95251-5	NM_001199156.1	NP_001186085.1

Amino acid sequences of our canonical and alternatively spliced KAT7

accession_id	Protein sequence
O95251-1	MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPK KYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKK RNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEAD NTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
O95251-2	MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPK KYPLRQTRSSGSETEQVVDFSDRGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTY GNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTI LRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNY NVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQ
O95251-3	MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLR YKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDT WYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVE PFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLR
O95251-4	MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPK KYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVW KHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKG
O95251-5	MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDK QIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASE DLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEV DGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSK VEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEA

Protein Functional Features

Main function of this protein. (from UniProt)

KAT7 (go to UniProt):O95251

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
O95251	Zinc finger	176	219	Note=CCHHC-type;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01143	Type=Deletion;Start=114;End=193
O95251	Zinc finger	176	219	Note=CCHHC-type;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01143	Type=Deletion;Start=114;End=193
O95251	Zinc finger	176	219	Note=CCHHC-type;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01143	Type=Deletion;Start=114;End=193
O95251	Region	1	173	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Region	1	173	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Region	1	173	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Region	1	173	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Region	1	173	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	39	106	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Compositional bias	39	106	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Compositional bias	107	123	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	107	123	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Compositional bias	107	123	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	107	123	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=55;End=113
O95251	Compositional bias	107	123	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	124	151	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	124	151	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	124	151	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	153	173	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	153	173	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193
O95251	Compositional bias	153	173	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=114;End=193

Gene Isoform Structures and Expression Levels for KAT7

Gene structures of our canonical and alternative spliced genes of KAT7
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of O95251-1

3D view using mol* of O95251-2

3D view using mol* of O95251-3

3D view using mol* of O95251-4

3D view using mol* of O95251-5

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of O95251-1

pLDDT distribution across the protein length of O95251-2

pLDDT distribution across the protein length of O95251-3

pLDDT distribution across the protein length of O95251-4

pLDDT distribution across the protein length of O95251-5

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of O95251-1

Ramachandran plot of O95251-3

Ramachandran plot of O95251-4

Ramachandran plot of O95251-5

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
O95251-1	1.023	330	1.001	669.536	0.502	0.732	0.983	0.749	1.16	0.646	0.573	350,351,422,428,429,430,431,432,433,434,435,437,43 8,441,443,461,468,469,470,472,473,474,475,476,477, 481,482,483,484,485,486,487,488,490,491,506,507,50 8,509,510,511,512,513,514,515,516,517,518,520,521, 523,524,525,528,551,553,554,557,558,561,562,583,58 4,587,588,591,592,594,596,597
O95251-2	1.057	290	1.006	519.302	0.386	0.784	1.029	0.734	1.241	0.591	0.588	240,241,312,318,319,320,321,322,323,324,325,327,32 8,331,333,351,362,363,364,365,366,367,371,372,373, 374,375,376,377,378,381,398,400,401,402,403,404,40 5,407,408,411
O95251-3	1.054	290	1.031	516.215	0.357	0.779	1.039	0.799	1.154	0.692	0.592	181,182,253,259,260,261,262,263,264,265,266,268,26 9,272,274,292,303,304,305,306,307,308,313,314,315, 316,317,318,319,322,338,339,340,341,342,343,344,34 5,346,348,349,350,352
O95251-4	1.023	420	1.052	926.443	0.521	0.711	0.92	0.739	0.965	0.766	0.647	320,321,398,399,400,401,402,403,404,411,413,431,44 3,444,445,446,447,452,453,455,457,458,460,461,462, 465,466,469,478,479,480,481,482,483,484,485,486,48 7,488,490,491,492,493,494,495,496,498,499,500,517, 518,524,527,528,530,531,532,553,554,557,558,561,56 2,564,565,566,567,568,570
O95251-5	1.035	416	1.005	820.456	0.419	0.751	1.032	0.739	1.181	0.625	0.745	211,212,262,289,290,291,292,293,294,295,299,302,30 4,322,333,334,335,336,337,338,342,343,344,345,346, 347,348,349,350,351,352,353,356,357,360,368,369,37 1,372,373,374,375,376,378,379,380,382,383,386,387, 390,391,394,395,408,409,449,452,453,455,456,457,45 8,459,461

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of O95251-1_O95251-1_5gk9_A.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of O95251-1_5gk9_A_O95251-2.pdb

3D view using mol* of O95251-1_5gk9_A_O95251-3.pdb

3D view using mol* of O95251-1_5gk9_A_O95251-4.pdb

3D view using mol* of O95251-1_5gk9_A_O95251-5.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of O95251-1_O95251-2.pdb

3D view using mol* of O95251-1_O95251-3.pdb

3D view using mol* of O95251-1_O95251-4.pdb

3D view using mol* of O95251-1_O95251-5.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/O95251-1_vs_O95251-2.png