Protein:ADCYAP1R1 |
Protein Summary |
 Gene summary |
| Gene name: ADCYAP1R1 | ASpdb.0 ID: 117 | Gene | Gene symbol | ADCYAP1R1 | Gene ID | 117 |
| Gene name | ADCYAP receptor type I |
| Synonyms | PAC1|PAC1R|PACAPR|PACAPRI |
| Cytomap | 7p14.3 |
| Type of gene | protein-coding |
| Description | pituitary adenylate cyclase-activating polypeptide type I receptorPACAP receptor 1PACAP type I receptorPACAP-R1adenylate cyclase activating polypeptide 1 (pituitary) receptor type Ipituitary adenylate cyclase activating polypeptide 1 receptor type I |
| Modification date | 20240403 |
| UniProtAcc | P41586 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | ADCYAP1R1 | GO:0043231 | intracellular membrane-bounded organelle | - |
| Gene | ADCYAP1R1 | GO:0043235 | receptor complex | 23382219 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P41586-1 | P41586-1_3n94_A.pdb | 3N94 | X-ray | 1.8 | A | 28 | 140 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-2 | 468 | 496 | 348 | 348 | Substitution | Y | YFSCVQKCYCKPQRAQQHSCKMSELSTIT | 348 | 376 |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-3 | 468 | 447 | 89 | 109 | Deletion | none | none | 88 | 88 |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-4 | 468 | 475 | 89 | 109 | Deletion | none | none | 88 | 88 |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-4 | 468 | 475 | 348 | 348 | Substitution | Y | YFSCVQKCYCKPQRAQQHSCKMSELSTIT | 327 | 355 |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-5 | 468 | 411 | 53 | 88 | Deletion | none | none | 52 | 52 |
| P41586 | ADCYAP1R1 | P41586-1 | P41586-5 | 468 | 411 | 89 | 109 | Deletion | none | none | 52 | 52 |
| Multiple sequence alignment of our canonical and alternatively spliced ADCYAP1R1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of ADCYAP1R1 |
| UniProt-id | ENSG | ENST | ENSP |
| P41586-1 | ENSG00000078549.16 | ENST00000304166.9 | ENSP00000306620.4 |
| P41586-2 | ENSG00000078549.16 | ENST00000396211.7 | ENSP00000379514.2 |
| P41586-2 | ENSG00000078549.16 | ENST00000705424.1 | ENSP00000516125.1 |
| P41586-3 | ENSG00000078549.16 | ENST00000409363.5 | ENSP00000387335.1 |
| UniProt-id | NM ID | NP ID |
| P41586-1 | NM_001118.4 | NP_001109.2 |
| P41586-2 | NM_001199635.1 | NP_001186564.1 |
| P41586-3 | NM_001199637.1 | NP_001186566.1 |
| P41586-4 | XM_017011737.1 | XP_016867226.1 |
| P41586-5 | XM_005249618.4 | XP_005249675.1 |
| Amino acid sequences of our canonical and alternatively spliced ADCYAP1R1 |
| accession_id | Protein sequence |
| P41586-1 | MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVW ETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYT IIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIP LFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILS |
| P41586-2 | MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVW ETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYT IIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQ RAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNR |
| P41586-3 | MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQDM GVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAI SVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYF DDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRER |
| P41586-4 | MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQDM GVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAI SVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYF DDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLAR STLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGG |
| P41586-5 | MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQD YYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCV VSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGI IVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRS |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| ADCYAP1R1 (go to UniProt):P41586 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P41586 | Topological domain | 21 | 155 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=89;End=109 |
| P41586 | Topological domain | 21 | 155 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=89;End=109 |
| P41586 | Topological domain | 21 | 155 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=53;End=88 |
| P41586 | Topological domain | 21 | 155 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=89;End=109 |
| P41586 | Topological domain | 333 | 350 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=348;End=348 |
| P41586 | Topological domain | 333 | 350 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=348;End=348 |
Gene Isoform Structures and Expression Levels for ADCYAP1R1 |
| Gene structures of our canonical and alternative spliced genes of ADCYAP1R1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P41586-1 |
| 3D view using mol* of P41586-2 |
| 3D view using mol* of P41586-3 |
| 3D view using mol* of P41586-4 |
| 3D view using mol* of P41586-5 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P41586-1 |
 |
| pLDDT distribution across the protein length of P41586-2 |
 |
| pLDDT distribution across the protein length of P41586-3 |
 |
| pLDDT distribution across the protein length of P41586-4 |
 |
| pLDDT distribution across the protein length of P41586-5 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P41586-1 |
 |
| Ramachandran plot of P41586-4 |
 |
| Ramachandran plot of P41586-5 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P41586-1 | 1.081 | 144 | 1.137 | 563.549 | 0.615 | 0.734 | 0.868 | 1.028 | 0.746 | 1.378 | 0.531 | 146,149,150,151,153,154,157,161,199,203,206,211,23 3,234,237,238,241,303,306,307,309,310,313,314,317, 366,369,370,371,372,373,374,376,377,378,379,381,38 2,385,386 |
| P41586-2 | 1.112 | 158 | 1.18 | 613.284 | 0.629 | 0.752 | 0.854 | 1.204 | 0.647 | 1.861 | 0.849 | 146,147,149,150,151,153,154,157,161,199,203,206,20 7,211,233,234,237,238,241,284,300,306,309,310,313, 314,317,393,394,397,398,400,401,402,403,404,406,40 7,409,410,412,413,414 |
| P41586-3 | 1.135 | 196 | 1.22 | 495.635 | 0.479 | 0.751 | 1.036 | 2.182 | 0.521 | 4.185 | 2.195 | 1,2,4,5,8,9,11,12,13,15,16,17,18,20,151,169,170,17 3,176,177,180,183,184,187,188,199,202,204,205,207, 208,211,214,249,250,253 |
| P41586-4 | 1.097 | 131 | 1.141 | 501.809 | 0.537 | 0.777 | 0.955 | 1.478 | 0.813 | 1.818 | 0.663 | 129,132,133,136,140,178,182,185,186,190,212,213,21 6,217,220,263,279,285,286,288,289,292,293,296,297, 373,376,377,379,380,381,388,389,392,393 |
| P41586-5 | 1.104 | 160 | 1.174 | 659.932 | 0.651 | 0.739 | 0.837 | 1.187 | 0.643 | 1.845 | 1.046 | 85,89,90,92,93,94,96,97,100,104,142,146,149,153,15 4,157,176,177,180,181,184,241,242,243,249,252,253, 256,257,260,309,313,315,317,319,320,321,322,324,32 5,328,329 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P41586-1_P41586-1_3n94_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P41586-1_3n94_A_P41586-2.pdb |
| 3D view using mol* of P41586-1_3n94_A_P41586-3.pdb |
| 3D view using mol* of P41586-1_3n94_A_P41586-4.pdb |
| 3D view using mol* of P41586-1_3n94_A_P41586-5.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P41586-1_P41586-2.pdb |
| 3D view using mol* of P41586-1_P41586-3.pdb |
| 3D view using mol* of P41586-1_P41586-4.pdb |
| 3D view using mol* of P41586-1_P41586-5.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P41586-1_vs_P41586-2.png |
 < |
| ./stats/secondary_structure/figure/P41586-1_vs_P41586-3.png |
 < |
| ./stats/secondary_structure/figure/P41586-1_vs_P41586-4.png |
 < |
| ./stats/secondary_structure/figure/P41586-1_vs_P41586-5.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P41586-1_vs_P41586-2.png |
 < |
| ./stats/relative_asa/P41586-1_vs_P41586-3.png |
 < |
| ./stats/relative_asa/P41586-1_vs_P41586-4.png |
 < |
| ./stats/relative_asa/P41586-1_vs_P41586-5.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to ADCYAP1R1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to ADCYAP1R1 |
| Previous studies relating to the alternative splicing of ADCYAP1R1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| ADCYAP1R1 | 12948842 | Expression of functional PACAP/VIP receptors in human prostate cancer and healthy tissue. | Vasoactive intestinal peptide (VIP) is involved in prostate cell proliferation and function. VIP and pituitary adenylate cyclase-activating peptide (PACAP) are similarly recognized by VPAC(1)/VPAC(2) receptors whereas PACAP binds with higher affinity than VIP to PAC(1) receptor. Here we systematically studied the presence and distribution of functional PAC(1), VPAC(1) and VPAC(2) receptors in human normal and malignant prostate tissue. Functional PACAP/VIP receptors were detected in normal and malignant prostate by adenylyl cyclase stimulation with PACAP-27/38 and VIP. RT-PCR experiments showed PAC(1) (various isoforms due to alternative splicing), VPAC(1) and VPAC(2) receptor expression at the mRNA level, whereas Western blots found the three receptor protein classes in normal and pathological conditions. No conclusive differences could be established when comparing control and cancer tissue samples. Immunohistochemistry showed a weaker immunostaining in tumoral than in normal epithelial cells for the three receptor subtypes. In conclusion, we demonstrate the expression of functional PAC(1), VPAC(1) and VPAC(2) receptors in human prostate as well as its maintenance after malignant transformation. | D011471 | Prostatic Neoplasms |
Clinically important variants in ADCYAP1R1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |