Protein:CSNK1A1 |
Protein Summary |
 Gene summary |
| Gene name: CSNK1A1 | ASpdb.0 ID: 1452 | Gene | Gene symbol | CSNK1A1 | Gene ID | 1452 |
| Gene name | casein kinase 1 alpha 1 |
| Synonyms | CK1|CK1a|CKIa|HEL-S-77p|HLCDGP1|PRO2975 |
| Cytomap | 5q32 |
| Type of gene | protein-coding |
| Description | casein kinase I isoform alphaCKI-alphaclock regulator kinasedown-regulated in lung cancerepididymis secretory sperm binding protein Li 77p |
| Modification date | 20240407 |
| UniProtAcc | P48729 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | CSNK1A1 | GO:0004674 | protein serine/threonine kinase activity | 18305108|19364825|22017875|22017877|25500533 |
| Gene | CSNK1A1 | GO:0005813 | centrosome | 21399614 |
| Gene | CSNK1A1 | GO:0005829 | cytosol | - |
| Gene | CSNK1A1 | GO:0005847 | mRNA cleavage and polyadenylation specificity factor complex | 18305108 |
| Gene | CSNK1A1 | GO:0006468 | protein phosphorylation | 18305108 |
| Gene | CSNK1A1 | GO:0016607 | nuclear speck | 18305108 |
| Gene | CSNK1A1 | GO:0030877 | beta-catenin destruction complex | 11955436 |
| Gene | CSNK1A1 | GO:0031670 | cellular response to nutrient | 22017875|22017877 |
| Gene | CSNK1A1 | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | 19364825 |
| Gene | CSNK1A1 | GO:0035025 | positive regulation of Rho protein signal transduction | 25500533 |
| Gene | CSNK1A1 | GO:0045095 | keratin filament | 23902688 |
| Gene | CSNK1A1 | GO:1904263 | positive regulation of TORC1 signaling | 22017875|22017877 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P48729-1 | P48729-1_6gzd_A.pdb | 6GZD | X-ray | 2.28 | A | 9 | 305 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P48729 | CSNK1A1 | P48729-1 | P48729-2 | 337 | 365 | 152 | 152 | Substitution | K | KCLESPVGKRKRSMTVSTSQDPSFSGLNQ | 152 | 180 |
| P48729 | CSNK1A1 | P48729-1 | P48729-3 | 337 | 325 | 324 | 335 | Deletion | none | none | 323 | 323 |
| Multiple sequence alignment of our canonical and alternatively spliced CSNK1A1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CSNK1A1 |
| UniProt-id | ENSG | ENST | ENSP |
| P48729-1 | ENSG00000113712.19 | ENST00000377843.8 | ENSP00000367074.2 |
| P48729-2 | ENSG00000113712.19 | ENST00000261798.10 | ENSP00000261798.6 |
| P48729-3 | ENSG00000113712.19 | ENST00000657001.1 | ENSP00000499757.1 |
| UniProt-id | NM ID | NP ID |
| P48729-1 | NM_001892.5 | NP_001883.4 |
| P48729-2 | NM_001025105.2 | NP_001020276.1 |
| P48729-3 | NM_001271741.1 | NP_001258670.1 |
| Amino acid sequences of our canonical and alternatively spliced CSNK1A1 |
| accession_id | Protein sequence |
| P48729-1 | MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVM DLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEE |
| P48729-2 | MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVM DLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMS TPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS |
| P48729-3 | MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVM DLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEE |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| CSNK1A1 (go to UniProt):P48729 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P48729 | Domain | 17 | 285 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=152;End=152 |
| P48729 | Region | 309 | 337 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=324;End=335 |
Gene Isoform Structures and Expression Levels for CSNK1A1 |
| Gene structures of our canonical and alternative spliced genes of CSNK1A1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P48729-1 |
| 3D view using mol* of P48729-2 |
| 3D view using mol* of P48729-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P48729-1 |
 |
| pLDDT distribution across the protein length of P48729-2 |
 |
| pLDDT distribution across the protein length of P48729-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P48729-1 |
 |
| Ramachandran plot of P48729-3 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P48729-1 | 1.066 | 112 | 1.103 | 244.902 | 0.479 | 0.75 | 0.978 | 1.102 | 0.878 | 1.255 | 1.254 | 23,24,25,26,27,31,44,46,60,64,90,91,92,93,94,95,96 ,99,138,140,141,143,156,157 |
| P48729-2 | 1.09 | 129 | 1.142 | 291.55 | 0.482 | 0.754 | 0.993 | 1.242 | 0.769 | 1.616 | 1.209 | 23,24,25,26,27,31,44,45,46,60,64,90,91,92,93,94,95 ,96,99,138,140,141,143,146,153,154,184,185 |
| P48729-3 | 1.047 | 111 | 1.089 | 242.501 | 0.495 | 0.716 | 0.932 | 0.922 | 0.86 | 1.073 | 1.269 | 23,24,25,26,27,31,44,45,46,60,64,90,91,92,93,94,95 ,96,99,138,140,141,143,156,157 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P48729-1_P48729-1_6gzd_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P48729-1_6gzd_A_P48729-2.pdb |
| 3D view using mol* of P48729-1_6gzd_A_P48729-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P48729-1_P48729-2.pdb |
| 3D view using mol* of P48729-1_P48729-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P48729-1_vs_P48729-2.png |
 < |
| ./stats/secondary_structure/figure/P48729-1_vs_P48729-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P48729-1_vs_P48729-2.png |
 < |
| ./stats/relative_asa/P48729-1_vs_P48729-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to CSNK1A1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P48729 | CSNK1A1 | DB12010 | Fostamatinib | approved, investigational | inhibitor |
Related Diseases to CSNK1A1 |
| Previous studies relating to the alternative splicing of CSNK1A1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| CSNK1A1 | 20696773 | Protein kinase CK1alphaLS promotes vascular cell proliferation and intimal hyperplasia. | Protein kinase CK1alpha regulates several fundamental cellular processes including proliferation and differentiation. Up to four forms of this kinase are expressed in vertebrates resulting from alternative splicing of exons; these exons encode either the L-insert located within the catalytic domain or the S-insert located at the C terminus of the protein. Whereas the L-insert is known to target the kinase to the nucleus, the functional significance of nuclear CK1alphaLS has been unclear. Here we demonstrate that selective L-insert-targeted short hairpin small interfering RNA-mediated knockdown of CK1alphaLS in human vascular endothelial cells and vascular smooth muscle cells impairs proliferation and abolishes hydrogen peroxide-stimulated proliferation of vascular smooth muscle cells, with the cells accumulating in G(0)/G(1). In addition, selective knockdown of CK1alphaLS in cultured human arteries inhibits vascular activation, preventing smooth muscle cell proliferation, intimal hyperplasia, and proteoglycan deposition. Knockdown of CK1alphaLS results in the harmonious down-regulation of its target substrate heterogeneous nuclear ribonucleoprotein C and results in the altered expression or alternative splicing of key genes involved in cellular activation including CXCR4, MMP3, CSF2, and SMURF1. Our results indicate that the nuclear form of CK1alpha in humans, CK1alphaLS, plays a critical role in vascular cell proliferation, cellular activation, and hydrogen peroxide-mediated mitogenic signal transduction. | D006965 | Hyperplasia |
Clinically important variants in CSNK1A1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |