ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:CTNND1

Protein Summary

Gene summary

Gene name: CTNND1
ASpdb.0 ID: 1500
	Gene
Gene symbol	CTNND1
Gene ID	1500
Gene name	catenin delta 1
Synonyms	BCDS2\|CAS\|CTNND\|P120CAS\|P120CTN\|p120\|p120(CAS)\|p120(CTN)
Cytomap	11q12.1
Type of gene	protein-coding
Description	catenin delta-1cadherin-associated Src substratecatenin (cadherin-associated protein), delta 1p120 catenin
Modification date	20240407
UniProtAcc	O60716

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	CTNND1	GO:0005634	nucleus	20123964
Gene	CTNND1	GO:0005737	cytoplasm	21998202
Gene	CTNND1	GO:0005737	cytoplasm	17047063
Gene	CTNND1	GO:0005886	plasma membrane	17115030
Gene	CTNND1	GO:0005911	cell-cell junction	12370829
Gene	CTNND1	GO:0009986	cell surface	17047063
Gene	CTNND1	GO:0016342	catenin complex	28051089
Gene	CTNND1	GO:0030496	midbody	15166316
Gene	CTNND1	GO:0045296	cadherin binding	15240885
Gene	CTNND1	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels	18602475
Gene	CTNND1	GO:0140311	protein sequestering activity	21998202

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
O60716-1	O60716-1_3l6x_A.pdb	3L6X	X-ray	2.4	A	358	852

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
O60716	CTNND1	O60716-1	O60716-10	968	908	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-10	968	908	626	631	Deletion	none	none	571	571
O60716	CTNND1	O60716-1	O60716-11	968	885	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-11	968	885	937	965	Deletion	none	none	882	882
O60716	CTNND1	O60716-1	O60716-12	968	893	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-12	968	893	880	900	Deletion	none	none	825	825
O60716	CTNND1	O60716-1	O60716-13	968	879	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-13	968	879	626	631	Deletion	none	none	571	571
O60716	CTNND1	O60716-1	O60716-13	968	879	937	965	Deletion	none	none	876	876
O60716	CTNND1	O60716-1	O60716-14	968	887	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-14	968	887	626	631	Deletion	none	none	571	571
O60716	CTNND1	O60716-1	O60716-14	968	887	880	900	Deletion	none	none	819	819
O60716	CTNND1	O60716-1	O60716-15	968	864	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-15	968	864	880	900	Deletion	none	none	825	825
O60716	CTNND1	O60716-1	O60716-15	968	864	937	965	Deletion	none	none	861	861
O60716	CTNND1	O60716-1	O60716-16	968	858	1	54	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-16	968	858	626	631	Deletion	none	none	571	571
O60716	CTNND1	O60716-1	O60716-16	968	858	880	900	Deletion	none	none	819	819
O60716	CTNND1	O60716-1	O60716-16	968	858	937	965	Deletion	none	none	855	855
O60716	CTNND1	O60716-1	O60716-17	968	867	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-18	968	861	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-18	968	861	626	631	Deletion	none	none	524	524
O60716	CTNND1	O60716-1	O60716-19	968	838	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-19	968	838	937	965	Deletion	none	none	835	835
O60716	CTNND1	O60716-1	O60716-2	968	962	626	631	Deletion	none	none	625	625
O60716	CTNND1	O60716-1	O60716-20	968	846	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-20	968	846	880	900	Deletion	none	none	778	778
O60716	CTNND1	O60716-1	O60716-21	968	832	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-21	968	832	626	631	Deletion	none	none	524	524
O60716	CTNND1	O60716-1	O60716-21	968	832	937	965	Deletion	none	none	829	829
O60716	CTNND1	O60716-1	O60716-22	968	840	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-22	968	840	626	631	Deletion	none	none	524	524
O60716	CTNND1	O60716-1	O60716-22	968	840	880	900	Deletion	none	none	772	772
O60716	CTNND1	O60716-1	O60716-23	968	817	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-23	968	817	880	900	Deletion	none	none	778	778
O60716	CTNND1	O60716-1	O60716-23	968	817	937	965	Deletion	none	none	814	814
O60716	CTNND1	O60716-1	O60716-24	968	811	1	101	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-24	968	811	626	631	Deletion	none	none	524	524
O60716	CTNND1	O60716-1	O60716-24	968	811	880	900	Deletion	none	none	772	772
O60716	CTNND1	O60716-1	O60716-24	968	811	937	965	Deletion	none	none	808	808
O60716	CTNND1	O60716-1	O60716-25	968	645	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-26	968	639	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-26	968	639	626	631	Deletion	none	none	302	302
O60716	CTNND1	O60716-1	O60716-27	968	616	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-27	968	616	937	965	Deletion	none	none	613	613
O60716	CTNND1	O60716-1	O60716-28	968	624	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-28	968	624	880	900	Deletion	none	none	556	556
O60716	CTNND1	O60716-1	O60716-29	968	610	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-29	968	610	626	631	Deletion	none	none	302	302
O60716	CTNND1	O60716-1	O60716-29	968	610	937	965	Deletion	none	none	607	607
O60716	CTNND1	O60716-1	O60716-3	968	939	937	965	Deletion	none	none	936	936
O60716	CTNND1	O60716-1	O60716-30	968	618	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-30	968	618	626	631	Deletion	none	none	302	302
O60716	CTNND1	O60716-1	O60716-30	968	618	880	900	Deletion	none	none	550	550
O60716	CTNND1	O60716-1	O60716-31	968	595	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-31	968	595	880	900	Deletion	none	none	556	556
O60716	CTNND1	O60716-1	O60716-31	968	595	937	965	Deletion	none	none	592	592
O60716	CTNND1	O60716-1	O60716-32	968	589	1	323	Deletion	none	none	0	0
O60716	CTNND1	O60716-1	O60716-32	968	589	626	631	Deletion	none	none	302	302
O60716	CTNND1	O60716-1	O60716-32	968	589	880	900	Deletion	none	none	550	550
O60716	CTNND1	O60716-1	O60716-32	968	589	937	965	Deletion	none	none	586	586
O60716	CTNND1	O60716-1	O60716-4	968	947	880	900	Deletion	none	none	879	879
O60716	CTNND1	O60716-1	O60716-5	968	933	626	631	Deletion	none	none	625	625
O60716	CTNND1	O60716-1	O60716-5	968	933	937	965	Deletion	none	none	930	930
O60716	CTNND1	O60716-1	O60716-6	968	941	626	631	Deletion	none	none	625	625
O60716	CTNND1	O60716-1	O60716-6	968	941	880	900	Deletion	none	none	873	873
O60716	CTNND1	O60716-1	O60716-7	968	918	880	900	Deletion	none	none	879	879
O60716	CTNND1	O60716-1	O60716-7	968	918	937	965	Deletion	none	none	915	915
O60716	CTNND1	O60716-1	O60716-8	968	912	626	631	Deletion	none	none	625	625
O60716	CTNND1	O60716-1	O60716-8	968	912	880	900	Deletion	none	none	873	873
O60716	CTNND1	O60716-1	O60716-8	968	912	937	965	Deletion	none	none	909	909
O60716	CTNND1	O60716-1	O60716-9	968	914	1	54	Deletion	none	none	0	0

Multiple sequence alignment of our canonical and alternatively spliced CTNND1

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CTNND1

UniProt-id	ENSG	ENST	ENSP
O60716-1	ENSG00000198561.16	ENST00000399050.10	ENSP00000382004.5
O60716-10	ENSG00000198561.16	ENST00000526357.5	ENSP00000433334.1
O60716-11	ENSG00000198561.16	ENST00000530748.5	ENSP00000436744.1
O60716-13	ENSG00000198561.16	ENST00000528621.5	ENSP00000432243.1
O60716-13	ENSG00000198561.16	ENST00000529526.5	ENSP00000436323.1
O60716-13	ENSG00000198561.16	ENST00000532649.5	ENSP00000435379.1
O60716-13	ENSG00000198561.16	ENST00000534579.5	ENSP00000435789.1
O60716-14	ENSG00000198561.16	ENST00000529873.5	ENSP00000435494.1
O60716-17	ENSG00000198561.16	ENST00000415361.6	ENSP00000403518.2
O60716-18	ENSG00000198561.16	ENST00000530094.5	ENSP00000437327.1
O60716-19	ENSG00000198561.16	ENST00000528232.5	ENSP00000435266.1
O60716-2	ENSG00000198561.16	ENST00000361332.8	ENSP00000354823.4
O60716-21	ENSG00000198561.16	ENST00000426142.6	ENSP00000409930.2
O60716-21	ENSG00000198561.16	ENST00000529986.5	ENSP00000437156.1
O60716-21	ENSG00000198561.16	ENST00000532245.5	ENSP00000434017.1
O60716-21	ENSG00000198561.16	ENST00000532463.5	ENSP00000432075.1
O60716-22	ENSG00000198561.16	ENST00000532787.5	ENSP00000434949.1
O60716-25	ENSG00000198561.16	ENST00000527467.5	ENSP00000434900.1
O60716-26	ENSG00000198561.16	ENST00000531014.5	ENSP00000432623.1
O60716-27	ENSG00000198561.16	ENST00000525902.5	ENSP00000434672.1
O60716-29	ENSG00000198561.16	ENST00000526772.5	ENSP00000433158.1
O60716-3	ENSG00000198561.16	ENST00000361796.9	ENSP00000354907.5
O60716-30	ENSG00000198561.16	ENST00000533667.5	ENSP00000437051.1
O60716-5	ENSG00000198561.16	ENST00000358694.10	ENSP00000351527.6
O60716-5	ENSG00000198561.16	ENST00000428599.6	ENSP00000413586.2
O60716-5	ENSG00000198561.16	ENST00000524630.5	ENSP00000436543.1
O60716-5	ENSG00000198561.16	ENST00000673683.1	ENSP00000500962.1
O60716-6	ENSG00000198561.16	ENST00000361391.10	ENSP00000354785.6
O60716-7	ENSG00000198561.16	ENST00000526938.5	ENSP00000432041.1
O60716-9	ENSG00000198561.16	ENST00000532844.5	ENSP00000433276.1

UniProt-id	NM ID	NP ID
O60716-1	NM_001085458.1	NP_001078927.1
O60716-10	NM_001206886.1	NP_001193815.1
O60716-11	NM_001206884.1	NP_001193813.1
O60716-13	NM_001206888.1	NP_001193817.1
O60716-13	NM_001206889.1	NP_001193818.1
O60716-13	NM_001206891.1	NP_001193820.1
O60716-14	NM_001206887.1	NP_001193816.1
O60716-17	NM_001085463.1	NP_001078932.1
O60716-18	NM_001085464.1	NP_001078933.1
O60716-19	NM_001085466.1	NP_001078935.1
O60716-2	NM_001085459.1	NP_001078928.1
O60716-21	NM_001085467.1	NP_001078936.1
O60716-21	NM_001085468.1	NP_001078937.1
O60716-21	NM_001085469.1	NP_001078938.1
O60716-21	NM_001206890.1	NP_001193819.1
O60716-22	NM_001085465.1	NP_001078934.1
O60716-3	NM_001206885.1	NP_001193814.1
O60716-5	NM_001085460.1	NP_001078929.1
O60716-5	NM_001085461.1	NP_001078930.1
O60716-5	NM_001085462.1	NP_001078931.1
O60716-6	NM_001331.2	NP_001322.1
O60716-9	NM_001206883.1	NP_001193812.1

Amino acid sequences of our canonical and alternatively spliced CTNND1

accession_id	Protein sequence
O60716-1	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINK SGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL
O60716-10	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQN LCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTL PLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV
O60716-11	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEAS AGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDT VISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHS
O60716-12	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEAS AGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDT VISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHS
O60716-13	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQN LCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTL
O60716-14	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQN LCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTL
O60716-15	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEAS AGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDT VISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHS
O60716-16	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQN LCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTL
O60716-17	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPAN DTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAAS GALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRA AALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERG
O60716-18	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFP KRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNL AVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQ TIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTL
O60716-19	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPAN DTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAAS GALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRA AALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERG
O60716-2	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPI EDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERV VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSE KEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYST
O60716-20	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPAN DTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAAS GALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRA AALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGT
O60716-21	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFP KRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNL AVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQ TIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTL
O60716-22	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFP KRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNL AVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQ TIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQD
O60716-23	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPAN DTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAAS GALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRA AALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGT
O60716-24	MQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPG PYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYG LEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEV IAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLR KARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLREC DGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFP KRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNL AVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQ TIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQK
O60716-25	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEA SAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSED TVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSH SYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVL
O60716-26	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQ NLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISIL NTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST LPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQ
O60716-27	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEA SAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSED TVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSH
O60716-28	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEA SAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSED TVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSH
O60716-29	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQ NLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISIL NTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST
O60716-3	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINK SGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL
O60716-30	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQ NLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISIL NTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST
O60716-31	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEA SAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSED TVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSH
O60716-32	MIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVL VGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVII PHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHRE IPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQ NLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISIL NTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST
O60716-4	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINK SGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSG
O60716-5	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPI EDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERV VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSE KEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYST
O60716-6	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPI EDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERV VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSE KEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDME
O60716-7	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINK SGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSG
O60716-8	MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQD HSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSV DLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNC DGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKGKKPI EDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERV VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSE KEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDNNYSTPNERGDHNRTLDRSGDLGDME
O60716-9	MANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETTVKKV VKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRV TRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDM IGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLV GLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEVIIP HSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI PQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEAS AGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDT VISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHS YDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLD

Protein Functional Features

Main function of this protein. (from UniProt)

CTNND1 (go to UniProt):O60716

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Region	855	944	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=937;End=965
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=101
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=323
O60716	Coiled coil	10	46	Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=54
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	873	888	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Compositional bias	889	910	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=880;End=900
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	622	629	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=626;End=631
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323
O60716	Motif	299	306	Note=Nuclear localization signal (NLS);Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:P30999	Type=Deletion;Start=1;End=323

Gene Isoform Structures and Expression Levels for CTNND1

Gene structures of our canonical and alternative spliced genes of CTNND1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of O60716-1

3D view using mol* of O60716-10

3D view using mol* of O60716-11

3D view using mol* of O60716-12

3D view using mol* of O60716-13

3D view using mol* of O60716-14

3D view using mol* of O60716-15

3D view using mol* of O60716-16

3D view using mol* of O60716-17

3D view using mol* of O60716-18

3D view using mol* of O60716-19

3D view using mol* of O60716-2

3D view using mol* of O60716-20

3D view using mol* of O60716-21

3D view using mol* of O60716-22

3D view using mol* of O60716-23

3D view using mol* of O60716-24

3D view using mol* of O60716-25

3D view using mol* of O60716-26

3D view using mol* of O60716-27

3D view using mol* of O60716-28

3D view using mol* of O60716-29

3D view using mol* of O60716-3

3D view using mol* of O60716-30

3D view using mol* of O60716-31

3D view using mol* of O60716-32

3D view using mol* of O60716-4

3D view using mol* of O60716-5

3D view using mol* of O60716-6

3D view using mol* of O60716-7

3D view using mol* of O60716-8

3D view using mol* of O60716-9

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of O60716-1

pLDDT distribution across the protein length of O60716-10

pLDDT distribution across the protein length of O60716-11

pLDDT distribution across the protein length of O60716-12

pLDDT distribution across the protein length of O60716-13

pLDDT distribution across the protein length of O60716-14

pLDDT distribution across the protein length of O60716-15

pLDDT distribution across the protein length of O60716-16

pLDDT distribution across the protein length of O60716-17

pLDDT distribution across the protein length of O60716-18

pLDDT distribution across the protein length of O60716-19

pLDDT distribution across the protein length of O60716-2

pLDDT distribution across the protein length of O60716-20

pLDDT distribution across the protein length of O60716-21

pLDDT distribution across the protein length of O60716-22

pLDDT distribution across the protein length of O60716-23

pLDDT distribution across the protein length of O60716-25

pLDDT distribution across the protein length of O60716-26

pLDDT distribution across the protein length of O60716-27

pLDDT distribution across the protein length of O60716-28

pLDDT distribution across the protein length of O60716-29

pLDDT distribution across the protein length of O60716-3

pLDDT distribution across the protein length of O60716-30

pLDDT distribution across the protein length of O60716-31

pLDDT distribution across the protein length of O60716-32

pLDDT distribution across the protein length of O60716-4

pLDDT distribution across the protein length of O60716-5

pLDDT distribution across the protein length of O60716-6

pLDDT distribution across the protein length of O60716-7

pLDDT distribution across the protein length of O60716-8

pLDDT distribution across the protein length of O60716-9

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of O60716-1

Ramachandran plot of O60716-10

Ramachandran plot of O60716-11

Ramachandran plot of O60716-13

Ramachandran plot of O60716-14

Ramachandran plot of O60716-15

Ramachandran plot of O60716-16

Ramachandran plot of O60716-17

Ramachandran plot of O60716-18

Ramachandran plot of O60716-2

Ramachandran plot of O60716-21

Ramachandran plot of O60716-23

Ramachandran plot of O60716-24

Ramachandran plot of O60716-25

Ramachandran plot of O60716-26

Ramachandran plot of O60716-27

Ramachandran plot of O60716-28

Ramachandran plot of O60716-29

Ramachandran plot of O60716-3

Ramachandran plot of O60716-30

Ramachandran plot of O60716-31

Ramachandran plot of O60716-32

Ramachandran plot of O60716-4

Ramachandran plot of O60716-6

Ramachandran plot of O60716-7

Ramachandran plot of O60716-9

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
O60716-1	1.045	217	1.094	672.966	0.591	0.702	0.9	1.004	0.818	1.228	1.022	270,271,272,273,274,275,276,277,278,280,281,363,36 4,365,366,371,374,382,384,385,386,388,389,391,392, 395,396,422,423,426,427,430,433,434,467,470,471,52 9
O60716-10	1.051	236	1.086	814.282	0.531	0.734	0.959	0.52	0.905	0.574	0.544	226,228,230,231,232,233,234,341,342,343,344,347,38 1,382,383,384,385,386,387,389,390,423,424,427,428, 429,432,481,482,485,486,527,530,531,619,622,665,81 1,812,813,814,815,816,817,818
O60716-11	1.081	249	1.143	543.312	0.549	0.722	0.893	1.292	0.705	1.832	0.884	218,219,220,221,222,223,224,225,226,228,231,312,32 0,327,328,330,331,332,334,335,337,338,341,368,369, 372,373,376,379,380,413,416,417,420,424,475
O60716-12	1.048	310	0.965	850.297	0.493	0.769	1.028	0.473	1.339	0.354	0.555	226,228,231,232,235,236,237,238,239,379,383,384,38 7,390,420,423,424,427,432,478,481,482,485,486,520, 523,524,527,530,531,534,623,625,628,632,635,636,66 9,670,671,674,675,678,681,718,719,720,722,723,763, 814,816,817,818,819,820,821,822
O60716-13	1.037	199	1.078	512.785	0.539	0.706	0.901	0.795	0.878	0.905	0.677	218,219,220,221,223,224,225,226,227,230,330,331,33 4,335,337,338,341,342,369,372,373,376,379,380,413, 416,417,475
O60716-14	1.048	141	1.005	362.208	0.451	0.769	1.052	0.806	1.215	0.663	0.753	218,220,221,222,223,224,225,226,228,327,330,331,33 4,337,341,369,372,373,376,379,380,413,416,417,471, 475
O60716-15	1.024	224	1.062	613.97	0.59	0.693	0.872	0.83	0.901	0.922	0.877	217,218,219,220,221,222,223,224,225,226,228,285,28 6,309,310,311,312,317,320,327,328,330,331,332,334, 335,337,338,341,367,369,372,373,376,379,380,413,41 6,417,471,475
O60716-16	1.03	344	0.933	854.756	0.48	0.743	0.952	0.2	1.389	0.144	0.69	232,233,234,235,236,237,238,239,344,383,384,385,38 7,390,423,424,427,428,429,432,481,482,485,486,527, 530,531,534,619,622,623,626,663,664,665,668,669,71 1,713,714,811,812,813,814,815,816,817
O60716-17	1.056	257	1.109	776.895	0.567	0.706	0.894	1.055	0.779	1.354	0.905	173,174,175,176,177,178,179,180,182,183,234,235,23 6,238,239,262,263,264,265,273,281,283,284,285,287, 288,290,291,294,295,321,322,325,326,329,332,333,36 6,369,370,428
O60716-18	1.02	465	0.999	1243.032	0.533	0.728	0.917	0.406	1.16	0.35	0.748	380,381,382,385,434,435,438,439,473,476,480,483,48 7,488,490,491,572,575,576,579,582,583,586,588,616, 617,618,621,622,625,628,629,632,664,665,666,667,66 9,670,673,676,677,710,713,714,717,750,753,754,755, 756,757,758,759,760,761,762,763,764,765,766,767,76 8,769,770,772,773,774,775,776,777,778,779
O60716-19	1.03	135	1.035	327.565	0.509	0.742	0.971	0.837	1.076	0.778	0.854	171,173,174,175,176,177,178,179,180,181,279,280,28 3,284,287,290,294,322,325,326,329,332,333,366,369, 370,373,424,428
O60716-2	1.081	215	1.155	748.426	0.587	0.703	0.891	1.1	0.636	1.73	0.973	274,275,276,277,278,279,280,336,337,339,340,341,34 2,363,364,365,366,371,374,382,384,385,386,388,389, 391,392,395,396,423,426,427,430,433,434,466,467,47 0,471
O60716-20	1.007	319	1.031	977.207	0.613	0.698	0.864	0.508	1.005	0.505	0.625	188,189,190,434,439,483,487,490,491,496,500,501,54 3,581,585,588,589,592,593,594,599,602,603,624,627, 628,631,634,635,638,639,640,641,671,672,675,676,67 9,682,683,716,719,720,723,724,760,761,762,763,764, 765,766,767,768,769,770,771,772,773,774,775,776,77 7
O60716-21	1.04	94	1.09	235.984	0.55	0.711	0.943	1.236	0.76	1.626	0.977	173,174,175,176,178,179,180,181,283,284,287,290,32 2,325,326,329,332,333,366,369,370,424,428
O60716-22	1.03	138	1.066	325.85	0.514	0.706	0.979	1.068	0.913	1.169	0.731	169,170,171,172,173,174,175,176,178,179,180,181,18 4,279,280,283,284,287,290,320,321,322,323,325,326, 329,332,333,366,369,370,373,376,424,428
O60716-23	1.037	151	1.033	394.45	0.547	0.754	1.021	0.774	1.101	0.704	1.127	172,173,174,175,176,178,179,180,181,183,184,187,18 8,279,280,283,284,287,290,322,323,325,326,329,332, 333,336,340,343,366,369,370,373,376,377,380,424,42 8,435,473
O60716-25	1.006	622	1.024	2078.58	0.586	0.707	0.862	0.449	1.043	0.43	0.678	68,71,72,73,75,78,103,110,111,114,115,116,118,121, 143,144,147,148,151,154,155,158,159,160,161,163,20 1,202,205,206,209,212,213,216,217,250,251,252,255, 258,261,262,356,359,366,372,401,402,405,409,412,41 3,416,448,449,450,451,453,454,457,460,461,494,497, 498,501,537,539,540,541,542,543,544,545,546,547,54 8,549,550,551,552,553,554,555,556,557,559,560,561, 562,563,564,565,566,567,568,569,570
O60716-26	1.054	146	1.104	519.645	0.644	0.713	0.882	0.84	0.809	1.038	1.002	68,69,71,72,73,78,103,104,107,110,111,114,115,116, 147,148,155,201,202,205,206,251,558,559,560,561,56 2,563,564,565,566,567,568,569,617,618,619,620,621, 622
O60716-27	1.069	224	0.993	692.517	0.48	0.801	1.039	0.522	1.312	0.398	0.491	68,71,72,73,74,75,78,107,110,111,114,115,116,121,1 47,151,154,155,158,202,205,206,209,212,213,560,562 ,563,564,565,566,567,570
O60716-28	1.002	324	0.958	947.023	0.554	0.701	0.894	0.138	1.234	0.112	0.608	154,158,159,160,163,212,213,215,216,217,222,251,25 4,258,261,262,265,354,355,356,359,366,369,370,371, 372,380,401,402,405,406,409,412,413,416,448,449,45 0,451,453,454,456,457,460,461,494,497,498,501,502, 531,534,542,543,544,545,546,547,548,549,550,551,55 2,553,554,602
O60716-29	1.017	594	1.006	1943.781	0.546	0.723	0.911	0.361	1.129	0.32	0.628	68,72,73,78,110,111,114,147,148,151,154,155,158,16 0,163,201,202,205,206,209,212,213,216,217,250,251, 252,254,255,258,261,262,265,268,269,278,279,313,31 5,350,353,354,357,360,361,363,364,365,366,371,374, 375,394,395,396,399,400,403,406,407,410,411,412,41 3,442,443,444,445,447,448,450,451,454,455,488,491, 492,495,496,524,528,531,532,533,534,535,536,537,53 8,539,540,541,542,543,544,545,546,547,548,549,556, 557,558,559,560,561,564
O60716-3	1.075	156	1.15	624.946	0.642	0.69	0.837	1.193	0.626	1.907	0.93	272,273,274,275,276,277,279,280,339,340,341,363,36 4,365,366,371,374,381,382,384,385,386,388,389,391, 422,423,426,427,430,433,434,466,467,470,471
O60716-30	1.034	329	1.037	1294.482	0.56	0.749	0.937	0.531	1.08	0.491	0.661	72,73,74,75,78,110,111,113,114,115,116,118,121,147 ,151,154,155,158,160,163,202,205,206,212,213,215,2 16,217,222,251,254,255,258,261,262,265,348,350,353 ,357,360,361,395,396,399,400,406,538,539,541,543,5 94,595,596,597,598,599,600,601,602
O60716-31	1.01	418	1.034	1768.508	0.619	0.703	0.873	0.54	1.007	0.537	0.635	38,40,61,62,65,68,69,71,72,73,75,78,99,100,103,104 ,107,110,111,113,114,115,117,118,120,121,144,147,1 48,151,154,155,158,160,163,201,202,205,206,209,212 ,213,216,217,222,250,251,252,254,255,258,261,262,2 65,356,359,363,366,367,402,405,406,412,544,545,547 ,549,571,572,573,574,575,576,577,578,579,580,581,5 82,583,584,585,586,587,588,589,590,592,594,595
O60716-32	0.998	416	1.025	1267.728	0.609	0.682	0.872	0.611	0.994	0.614	0.617	12,13,14,15,16,17,18,19,20,40,41,42,43,48,51,59,62 ,63,65,66,68,69,71,72,73,74,75,76,78,100,103,104,1 07,110,111,114,115,116,118,121,144,148,151,154,155 ,158,159,160,163,212,213,217,251,254,258,261,350,3 53,354,357,360,395,396,399,400,442,444,445,538,539 ,540,541,542,543,544,545,546,547,548,549,550,551,5 52,554
O60716-4	1.021	750	1.051	2168.789	0.586	0.707	0.893	0.637	0.961	0.663	0.721	272,273,274,275,276,277,278,279,280,281,282,283,28 4,285,286,287,288,289,290,291,292,336,338,339,340, 341,342,343,363,365,366,371,374,382,384,385,386,38 8,389,391,392,395,396,397,398,401,422,423,426,427, 430,433,434,437,438,439,441,444,467,470,471,474,47 7,478,481,482,483,486,524,525,528,529,532,535,536, 539,540,573,574,577,578,581,584,585,592,677,678,67 9,682,683,689,724,725,728,729,732,735,773,774,776, 777,780,783,784,817,820,821,824,825,865,867,868,87 0,871,872,873,874,875,876,877,878
O60716-5	1.063	298	1.125	1107.204	0.587	0.701	0.88	1.054	0.722	1.46	1.095	19,22,23,25,26,270,271,272,273,274,275,276,277,278 ,279,280,281,282,336,338,363,364,365,366,371,374,3 81,382,384,385,386,388,389,391,392,395,422,423,426 ,427,430,433,434,437,467,470,471,474,477,478,524,5 25,528,529,574
O60716-6	1.056	227	0.966	704.865	0.556	0.781	1.037	0.406	1.357	0.299	0.657	280,281,282,283,285,286,288,289,290,291,292,433,43 7,470,474,477,478,481,486,529,532,535,536,539,540, 574,577,578,581,584,673,676,717,718,719,722,765,76 7,768,862,863,864,865,866,867,868,869,870,871,872
O60716-7	1.063	138	1.122	470.939	0.596	0.707	0.922	0.926	0.744	1.245	0.86	272,273,274,275,276,277,280,366,384,385,386,388,38 9,391,392,395,422,423,426,427,430,433,434,437,467, 470,471,478
O60716-8	1.041	192	1.084	483.63	0.552	0.706	0.897	1.004	0.857	1.172	1.039	273,274,275,276,277,278,279,280,282,365,366,371,37 4,382,384,385,386,388,389,391,392,395,423,426,427, 430,433,434,467,470,471,525,529
O60716-9	1.05	274	1.078	729.218	0.56	0.748	0.946	0.598	0.954	0.627	0.966	481,486,491,530,534,535,538,625,628,632,635,636,67 1,674,675,678,681,682,719,722,723,726,729,730,733, 762,763,766,767,770,810,811,812,813,814,815,816,81 7,818,819,820,821,822,832,833,834,835,836,837,839

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of O60716-1_O60716-1_3l6x_A.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of O60716-1_3l6x_A_O60716-10.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-11.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-12.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-13.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-14.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-15.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-16.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-17.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-18.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-19.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-2.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-20.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-21.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-22.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-23.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-24.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-25.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-26.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-27.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-28.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-29.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-3.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-30.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-31.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-32.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-4.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-5.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-6.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-7.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-8.pdb

3D view using mol* of O60716-1_3l6x_A_O60716-9.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of O60716-1_O60716-10.pdb

3D view using mol* of O60716-1_O60716-11.pdb

3D view using mol* of O60716-1_O60716-12.pdb

3D view using mol* of O60716-1_O60716-13.pdb

3D view using mol* of O60716-1_O60716-14.pdb

3D view using mol* of O60716-1_O60716-15.pdb

3D view using mol* of O60716-1_O60716-16.pdb

3D view using mol* of O60716-1_O60716-17.pdb

3D view using mol* of O60716-1_O60716-18.pdb

3D view using mol* of O60716-1_O60716-19.pdb

3D view using mol* of O60716-1_O60716-2.pdb

3D view using mol* of O60716-1_O60716-20.pdb

3D view using mol* of O60716-1_O60716-21.pdb

3D view using mol* of O60716-1_O60716-22.pdb

3D view using mol* of O60716-1_O60716-23.pdb

3D view using mol* of O60716-1_O60716-24.pdb

3D view using mol* of O60716-1_O60716-25.pdb

3D view using mol* of O60716-1_O60716-26.pdb

3D view using mol* of O60716-1_O60716-27.pdb

3D view using mol* of O60716-1_O60716-28.pdb

3D view using mol* of O60716-1_O60716-29.pdb

3D view using mol* of O60716-1_O60716-3.pdb

3D view using mol* of O60716-1_O60716-30.pdb

3D view using mol* of O60716-1_O60716-31.pdb

3D view using mol* of O60716-1_O60716-32.pdb

3D view using mol* of O60716-1_O60716-4.pdb

3D view using mol* of O60716-1_O60716-5.pdb

3D view using mol* of O60716-1_O60716-6.pdb

3D view using mol* of O60716-1_O60716-7.pdb

3D view using mol* of O60716-1_O60716-8.pdb

3D view using mol* of O60716-1_O60716-9.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/O60716-1_vs_O60716-10.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-11.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-12.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-13.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-14.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-15.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-16.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-17.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-18.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-19.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-2.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-20.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-21.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-22.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-23.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-24.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-25.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-26.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-27.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-28.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-29.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-3.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-30.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-31.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-32.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-4.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-5.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-6.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-7.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-8.png

./stats/secondary_structure/figure/O60716-1_vs_O60716-9.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/O60716-1_vs_O60716-10.png

./stats/relative_asa/O60716-1_vs_O60716-11.png

./stats/relative_asa/O60716-1_vs_O60716-12.png

./stats/relative_asa/O60716-1_vs_O60716-13.png

./stats/relative_asa/O60716-1_vs_O60716-14.png

./stats/relative_asa/O60716-1_vs_O60716-15.png

./stats/relative_asa/O60716-1_vs_O60716-16.png

./stats/relative_asa/O60716-1_vs_O60716-17.png

./stats/relative_asa/O60716-1_vs_O60716-18.png

./stats/relative_asa/O60716-1_vs_O60716-19.png

./stats/relative_asa/O60716-1_vs_O60716-2.png

./stats/relative_asa/O60716-1_vs_O60716-20.png

./stats/relative_asa/O60716-1_vs_O60716-21.png

./stats/relative_asa/O60716-1_vs_O60716-22.png

./stats/relative_asa/O60716-1_vs_O60716-23.png

./stats/relative_asa/O60716-1_vs_O60716-24.png

./stats/relative_asa/O60716-1_vs_O60716-25.png

./stats/relative_asa/O60716-1_vs_O60716-26.png

./stats/relative_asa/O60716-1_vs_O60716-27.png

./stats/relative_asa/O60716-1_vs_O60716-28.png

./stats/relative_asa/O60716-1_vs_O60716-29.png

./stats/relative_asa/O60716-1_vs_O60716-3.png

./stats/relative_asa/O60716-1_vs_O60716-30.png

./stats/relative_asa/O60716-1_vs_O60716-31.png

./stats/relative_asa/O60716-1_vs_O60716-32.png

./stats/relative_asa/O60716-1_vs_O60716-4.png

./stats/relative_asa/O60716-1_vs_O60716-5.png

./stats/relative_asa/O60716-1_vs_O60716-6.png

./stats/relative_asa/O60716-1_vs_O60716-7.png

./stats/relative_asa/O60716-1_vs_O60716-8.png

./stats/relative_asa/O60716-1_vs_O60716-9.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=101
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=323
O60716	Region	1	357	Note=Necessary and sufficient for interaction with CCDC85B;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:25009281;Dbxref=PMID:25009281	Type=Deletion;Start=1;End=54

Interactors from STRING.

Gene name

Interactors

Related Drugs to CTNND1

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession

Gene name

DrugBank ID

Drug name

Drug group

Actions

Related Diseases to CTNND1

Previous studies relating to the alternative splicing of CTNND1 and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
CTNND1	10393933	Nuclear localization of the p120(ctn) Armadillo-like catenin is counteracted by a nuclear export signal and by E-cadherin expression.	The Armadillo protein p120(ctn) associates with the cytoplasmic domain of cadherins and accumulates at cell-cell junctions. Particular Armadillo proteins such as beta-catenin and plakophilins show a partly nuclear location, suggesting gene-regulatory activities. For different human E-cadherin-negative carcinoma cancer cell lines we found expression of endogenous p120(ctn) in the nucleus. Expression of E-cadherin directed p120(ctn) out of the nucleus. Previously, we reported that the human p120(ctn) gene might encode up to 32 protein isoforms as products of alternative splicing. Overexpression of p120(ctn) isoforms B in various cell lines resulted in cytoplasmic immunopositivity but never in nuclear staining. In contrast, upon expression of p120(ctn) cDNAs lacking exon B, the isoforms were detectable within both nuclei and cytoplasm. A putative nuclear export signal (NES) with a characteristic leucine-rich motif is encoded by exon B. This sequence element was shown to be required for nuclear export and to function autonomously when fused to a carrier protein and microinjected into cell nuclei. Moreover, the NES function of endogenously or exogenously expressed p120(ctn) isoforms B was sensitive to the nuclear export inhibitor leptomycin B. Expression of exogenous E-cadherin down-regulated nuclear p120(ctn) whereas activation of protein kinase C increased the level of nuclear p120(ctn). These results reveal molecular mechanisms controlling the subcellular distribution of p120(ctn).	D000230	Adenocarcinoma
CTNND1	10393933	Nuclear localization of the p120(ctn) Armadillo-like catenin is counteracted by a nuclear export signal and by E-cadherin expression.	The Armadillo protein p120(ctn) associates with the cytoplasmic domain of cadherins and accumulates at cell-cell junctions. Particular Armadillo proteins such as beta-catenin and plakophilins show a partly nuclear location, suggesting gene-regulatory activities. For different human E-cadherin-negative carcinoma cancer cell lines we found expression of endogenous p120(ctn) in the nucleus. Expression of E-cadherin directed p120(ctn) out of the nucleus. Previously, we reported that the human p120(ctn) gene might encode up to 32 protein isoforms as products of alternative splicing. Overexpression of p120(ctn) isoforms B in various cell lines resulted in cytoplasmic immunopositivity but never in nuclear staining. In contrast, upon expression of p120(ctn) cDNAs lacking exon B, the isoforms were detectable within both nuclei and cytoplasm. A putative nuclear export signal (NES) with a characteristic leucine-rich motif is encoded by exon B. This sequence element was shown to be required for nuclear export and to function autonomously when fused to a carrier protein and microinjected into cell nuclei. Moreover, the NES function of endogenously or exogenously expressed p120(ctn) isoforms B was sensitive to the nuclear export inhibitor leptomycin B. Expression of exogenous E-cadherin down-regulated nuclear p120(ctn) whereas activation of protein kinase C increased the level of nuclear p120(ctn). These results reveal molecular mechanisms controlling the subcellular distribution of p120(ctn).	D001943	Breast Neoplasms
CTNND1	10393933	Nuclear localization of the p120(ctn) Armadillo-like catenin is counteracted by a nuclear export signal and by E-cadherin expression.	The Armadillo protein p120(ctn) associates with the cytoplasmic domain of cadherins and accumulates at cell-cell junctions. Particular Armadillo proteins such as beta-catenin and plakophilins show a partly nuclear location, suggesting gene-regulatory activities. For different human E-cadherin-negative carcinoma cancer cell lines we found expression of endogenous p120(ctn) in the nucleus. Expression of E-cadherin directed p120(ctn) out of the nucleus. Previously, we reported that the human p120(ctn) gene might encode up to 32 protein isoforms as products of alternative splicing. Overexpression of p120(ctn) isoforms B in various cell lines resulted in cytoplasmic immunopositivity but never in nuclear staining. In contrast, upon expression of p120(ctn) cDNAs lacking exon B, the isoforms were detectable within both nuclei and cytoplasm. A putative nuclear export signal (NES) with a characteristic leucine-rich motif is encoded by exon B. This sequence element was shown to be required for nuclear export and to function autonomously when fused to a carrier protein and microinjected into cell nuclei. Moreover, the NES function of endogenously or exogenously expressed p120(ctn) isoforms B was sensitive to the nuclear export inhibitor leptomycin B. Expression of exogenous E-cadherin down-regulated nuclear p120(ctn) whereas activation of protein kinase C increased the level of nuclear p120(ctn). These results reveal molecular mechanisms controlling the subcellular distribution of p120(ctn).	D003110	Colonic Neoplasms
CTNND1	18407999	A p120 catenin isoform switch affects Rho activity, induces tumor cell invasion, and predicts metastatic disease.	p120 catenin is a cadherin-associated protein that regulates Rho GTPases and promotes the invasiveness of E-cadherin-deficient cancer cells. Multiple p120 isoforms are expressed in cells via alternative splicing, and all of them are essential for HGF signaling to Rac1. However, only full-length p120 (isoform 1) promotes invasiveness. This selective ability of p120 isoform 1 is mediated by reduced RhoA activity, both under basal conditions and following HGF treatment. All p120 isoforms can bind RhoA in vitro, via a central RhoA binding site. However, only the cooperative binding of RhoA to the central p120 domain and to the alternatively spliced p120 N terminus stabilizes RhoA binding and inhibits RhoA activity. Consistent with this, increased expression of p120 isoform 1, when compared with other p120 isoforms, is predictive of renal tumor micrometastasis and systemic progression, following nephrectomy. Furthermore, ectopic expression of the RhoA-binding, N-terminal domain of p120 is sufficient to block the ability of p120 isoform 1 to inhibit RhoA and to promote invasiveness. The data indicate that the increased expression of p120 isoform 1 during tumor progression contributes to the invasive phenotype of cadherin-deficient carcinomas and that the N-terminal domain of p120 is a valid therapeutic target.	D002292	Carcinoma, Renal Cell
CTNND1	18407999	A p120 catenin isoform switch affects Rho activity, induces tumor cell invasion, and predicts metastatic disease.	p120 catenin is a cadherin-associated protein that regulates Rho GTPases and promotes the invasiveness of E-cadherin-deficient cancer cells. Multiple p120 isoforms are expressed in cells via alternative splicing, and all of them are essential for HGF signaling to Rac1. However, only full-length p120 (isoform 1) promotes invasiveness. This selective ability of p120 isoform 1 is mediated by reduced RhoA activity, both under basal conditions and following HGF treatment. All p120 isoforms can bind RhoA in vitro, via a central RhoA binding site. However, only the cooperative binding of RhoA to the central p120 domain and to the alternatively spliced p120 N terminus stabilizes RhoA binding and inhibits RhoA activity. Consistent with this, increased expression of p120 isoform 1, when compared with other p120 isoforms, is predictive of renal tumor micrometastasis and systemic progression, following nephrectomy. Furthermore, ectopic expression of the RhoA-binding, N-terminal domain of p120 is sufficient to block the ability of p120 isoform 1 to inhibit RhoA and to promote invasiveness. The data indicate that the increased expression of p120 isoform 1 during tumor progression contributes to the invasive phenotype of cadherin-deficient carcinomas and that the N-terminal domain of p120 is a valid therapeutic target.	D009361	Neoplasm Invasiveness
CTNND1	18407999	A p120 catenin isoform switch affects Rho activity, induces tumor cell invasion, and predicts metastatic disease.	p120 catenin is a cadherin-associated protein that regulates Rho GTPases and promotes the invasiveness of E-cadherin-deficient cancer cells. Multiple p120 isoforms are expressed in cells via alternative splicing, and all of them are essential for HGF signaling to Rac1. However, only full-length p120 (isoform 1) promotes invasiveness. This selective ability of p120 isoform 1 is mediated by reduced RhoA activity, both under basal conditions and following HGF treatment. All p120 isoforms can bind RhoA in vitro, via a central RhoA binding site. However, only the cooperative binding of RhoA to the central p120 domain and to the alternatively spliced p120 N terminus stabilizes RhoA binding and inhibits RhoA activity. Consistent with this, increased expression of p120 isoform 1, when compared with other p120 isoforms, is predictive of renal tumor micrometastasis and systemic progression, following nephrectomy. Furthermore, ectopic expression of the RhoA-binding, N-terminal domain of p120 is sufficient to block the ability of p120 isoform 1 to inhibit RhoA and to promote invasiveness. The data indicate that the increased expression of p120 isoform 1 during tumor progression contributes to the invasive phenotype of cadherin-deficient carcinomas and that the N-terminal domain of p120 is a valid therapeutic target.	D009362	Neoplasm Metastasis
CTNND1	19150613	P120-catenin isoforms 1A and 3A differently affect invasion and proliferation of lung cancer cells.	Different isoforms of p120-catenin (p120ctn), a member of the Armadillo gene family, are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons. When expressed in cancer cells, these isoforms may confer different properties with respect to cell adhesion and invasion. We have previously reported that the p120ctn isoforms 1 and 3 were the most highly expressed isoforms in normal lung tissues, and their expression level was reduced in lung tumor cells. To precisely define their biological roles, we transfected p120ctn isoforms 1A and 3A into the lung cancer cell lines A549 and NCI-H460. Enhanced expression of p120ctn isoform 1A not only upregulated E-cadherin and beta-catenin, but also downregulated the Rac1 activity, and as a result, inhibited the ability of cells to invade. In contrast, overexpression of p120ctn isoform 3A led to the inactivation of Cdc42 and the activation of RhoA, and had a smaller influence on invasion. However, we found that isoform 3A had a greater ability than isoform 1A in both inhibiting the cell cycle and reducing tumor cell proliferation. The present study revealed that p120ctn isoforms 1A and 3A differently regulated the adhesive, proliferative, and invasive properties of lung cancer cells through distinct mechanisms.	D000230	Adenocarcinoma
CTNND1	19150613	P120-catenin isoforms 1A and 3A differently affect invasion and proliferation of lung cancer cells.	Different isoforms of p120-catenin (p120ctn), a member of the Armadillo gene family, are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons. When expressed in cancer cells, these isoforms may confer different properties with respect to cell adhesion and invasion. We have previously reported that the p120ctn isoforms 1 and 3 were the most highly expressed isoforms in normal lung tissues, and their expression level was reduced in lung tumor cells. To precisely define their biological roles, we transfected p120ctn isoforms 1A and 3A into the lung cancer cell lines A549 and NCI-H460. Enhanced expression of p120ctn isoform 1A not only upregulated E-cadherin and beta-catenin, but also downregulated the Rac1 activity, and as a result, inhibited the ability of cells to invade. In contrast, overexpression of p120ctn isoform 3A led to the inactivation of Cdc42 and the activation of RhoA, and had a smaller influence on invasion. However, we found that isoform 3A had a greater ability than isoform 1A in both inhibiting the cell cycle and reducing tumor cell proliferation. The present study revealed that p120ctn isoforms 1A and 3A differently regulated the adhesive, proliferative, and invasive properties of lung cancer cells through distinct mechanisms.	D008175	Lung Neoplasms
CTNND1	19150613	P120-catenin isoforms 1A and 3A differently affect invasion and proliferation of lung cancer cells.	Different isoforms of p120-catenin (p120ctn), a member of the Armadillo gene family, are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons. When expressed in cancer cells, these isoforms may confer different properties with respect to cell adhesion and invasion. We have previously reported that the p120ctn isoforms 1 and 3 were the most highly expressed isoforms in normal lung tissues, and their expression level was reduced in lung tumor cells. To precisely define their biological roles, we transfected p120ctn isoforms 1A and 3A into the lung cancer cell lines A549 and NCI-H460. Enhanced expression of p120ctn isoform 1A not only upregulated E-cadherin and beta-catenin, but also downregulated the Rac1 activity, and as a result, inhibited the ability of cells to invade. In contrast, overexpression of p120ctn isoform 3A led to the inactivation of Cdc42 and the activation of RhoA, and had a smaller influence on invasion. However, we found that isoform 3A had a greater ability than isoform 1A in both inhibiting the cell cycle and reducing tumor cell proliferation. The present study revealed that p120ctn isoforms 1A and 3A differently regulated the adhesive, proliferative, and invasive properties of lung cancer cells through distinct mechanisms.	D009361	Neoplasm Invasiveness
CTNND1	24711643	Identifying biological pathways that underlie primordial short stature using network analysis.	Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.	D004392	Dwarfism
CTNND1	24711643	Identifying biological pathways that underlie primordial short stature using network analysis.	Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.	D006130	Growth Disorders
CTNND1	24711643	Identifying biological pathways that underlie primordial short stature using network analysis.	Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.	D009123	Muscle Hypotonia

Clinically important variants in CTNND1

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance