Protein:DRD3 |
Protein Summary |
 Gene summary |
| Gene name: DRD3 | ASpdb.0 ID: 1814 | Gene | Gene symbol | DRD3 | Gene ID | 1814 |
| Gene name | dopamine receptor D3 |
| Synonyms | D3DR|ETM1|FET1 |
| Cytomap | 3q13.31 |
| Type of gene | protein-coding |
| Description | D(3) dopamine receptoressential tremor 1 |
| Modification date | 20240411 |
| UniProtAcc | P35462 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | DRD3 | GO:0001591 | dopamine neurotransmitter receptor activity, coupled via Gi/Go | 8301582 |
| Gene | DRD3 | GO:0002031 | G protein-coupled receptor internalization | 18424554 |
| Gene | DRD3 | GO:0005886 | plasma membrane | 8413587|16386234|18424554|20531939 |
| Gene | DRD3 | GO:0006874 | intracellular calcium ion homeostasis | 7911712 |
| Gene | DRD3 | GO:0007186 | G protein-coupled receptor signaling pathway | 7911712 |
| Gene | DRD3 | GO:0007191 | adenylate cyclase-activating dopamine receptor signaling pathway | 18424554 |
| Gene | DRD3 | GO:0007195 | adenylate cyclase-inhibiting dopamine receptor signaling pathway | 7907363|8666994|18424554 |
| Gene | DRD3 | GO:0034776 | response to histamine | 16839358 |
| Gene | DRD3 | GO:0050482 | arachidonic acid secretion | 8301582 |
| Gene | DRD3 | GO:0050709 | negative regulation of protein secretion | 16839358 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P35462-1 | P35462-1_3pbl_A.pdb | 3PBL | X-ray | 2.89 | A | 319 | 400 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P35462 | DRD3 | P35462-1 | P35462-3 | 400 | 367 | 287 | 320 | Substitution | SPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGV | M | 287 | 287 |
| Multiple sequence alignment of our canonical and alternatively spliced DRD3 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of DRD3 |
| UniProt-id | ENSG | ENST | ENSP |
| P35462-1 | ENSG00000151577.14 | ENST00000383673.5 | ENSP00000373169.2 |
| P35462-1 | ENSG00000151577.14 | ENST00000460779.5 | ENSP00000419402.1 |
| P35462-1 | ENSG00000151577.14 | ENST00000467632.5 | ENSP00000420662.1 |
| P35462-3 | ENSG00000151577.14 | ENST00000295881.9 | ENSP00000295881.6 |
| UniProt-id | NM ID | NP ID |
| P35462-1 | NM_000796.5 | NP_000787.2 |
| P35462-1 | NM_001282563.2 | NP_001269492.1 |
| P35462-1 | NM_001290809.1 | NP_001277738.1 |
| P35462-3 | NM_033663.5 | NP_387512.3 |
| Amino acid sequences of our canonical and alternatively spliced DRD3 |
| accession_id | Protein sequence |
| P35462-1 | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLE VTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQ ERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV |
| P35462-3 | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLE VTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQ ERGGELKREEKTRNSLMPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKA |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| DRD3 (go to UniProt):P35462 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P35462 | Topological domain | 210 | 329 | Note=Cytoplasmic;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:21097933;Dbxref=PMID:21097933 | Type=Substitution;Start=287;End=320 |
Gene Isoform Structures and Expression Levels for DRD3 |
| Gene structures of our canonical and alternative spliced genes of DRD3 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P35462-1 |
| 3D view using mol* of P35462-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P35462-1 |
 |
| pLDDT distribution across the protein length of P35462-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P35462-1 |
 |
| Ramachandran plot of P35462-3 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P35462-1 | 1.106 | 163 | 1.141 | 527.877 | 0.491 | 0.807 | 1.01 | 0.733 | 0.87 | 0.842 | 2.177 | 28,29,32,36,86,89,90,93,94,106,107,110,111,114,180 ,181,182,183,189,192,193,196,342,345,346,349,352,3 53,360,362,363,365,366,369,372,373 |
| P35462-3 | 1.112 | 177 | 1.152 | 511.756 | 0.443 | 0.805 | 1.052 | 1.03 | 0.832 | 1.238 | 2.868 | 29,32,33,36,86,89,90,91,93,94,106,107,110,111,114, 115,180,181,182,183,192,196,309,312,313,316,329,33 0,332,333,334,336,339,340 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P35462-1_P35462-1_3pbl_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P35462-1_3pbl_A_P35462-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P35462-1_P35462-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P35462-1_vs_P35462-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P35462-1_vs_P35462-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to DRD3 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P35462 | DRD3 | DB12478 | Piribedil | investigational | |
| P35462 | DRD3 | DB01186 | Pergolide | approved, investigational, vet_approved, withdrawn | agonist |
| P35462 | DRD3 | DB01239 | Chlorprothixene | approved, experimental, investigational, withdrawn | antagonist |
| P35462 | DRD3 | DB01392 | Yohimbine | approved, investigational, vet_approved | antagonist |
| P35462 | DRD3 | DB00490 | Buspirone | approved, investigational | antagonist |
| P35462 | DRD3 | DB13025 | Tiapride | investigational | blocker |
| P35462 | DRD3 | DB01200 | Bromocriptine | approved, investigational, withdrawn | agonist |
| P35462 | DRD3 | DB00413 | Pramipexole | approved, investigational | agonist |
| P35462 | DRD3 | DB06288 | Amisulpride | approved, investigational | antagonist |
| P35462 | DRD3 | DB00543 | Amoxapine | approved | antagonist |
| P35462 | DRD3 | DB12061 | Pardoprunox | investigational | |
| P35462 | DRD3 | DB01224 | Quetiapine | approved | ligand |
| P35462 | DRD3 | DB00714 | Apomorphine | approved, investigational | agonist |
| P35462 | DRD3 | DB00320 | Dihydroergotamine | approved, investigational | agonist |
| P35462 | DRD3 | DB04946 | Iloperidone | approved | antagonist |
| P35462 | DRD3 | DB01235 | Levodopa | approved | agonist |
| P35462 | DRD3 | DB00268 | Ropinirole | approved, investigational | agonist |
| P35462 | DRD3 | DB14185 | Aripiprazole lauroxil | approved, investigational | |
| P35462 | DRD3 | DB00477 | Chlorpromazine | approved, investigational, vet_approved | inhibitor |
| P35462 | DRD3 | DB01238 | Aripiprazole | approved, investigational | antagonist, partial agonist |
| P35462 | DRD3 | DB00589 | Lisuride | approved, investigational | agonist |
| P35462 | DRD3 | DB01184 | Domperidone | approved, investigational, vet_approved | antagonist |
| P35462 | DRD3 | DB09014 | Captodiame | experimental | agonist |
| P35462 | DRD3 | DB05766 | Norclozapine | investigational | |
| P35462 | DRD3 | DB00391 | Sulpiride | approved, investigational | antagonist |
| P35462 | DRD3 | DB01100 | Pimozide | approved | antagonist |
| P35462 | DRD3 | DB09223 | Blonanserin | investigational | antagonist |
| P35462 | DRD3 | DB09128 | Brexpiprazole | approved, investigational | partial agonist |
| P35462 | DRD3 | DB00409 | Remoxipride | approved, withdrawn | antagonist |
| P35462 | DRD3 | DB00875 | Flupentixol | approved, investigational, withdrawn | antagonist |
| P35462 | DRD3 | DB05271 | Rotigotine | approved | agonist |
| P35462 | DRD3 | DB00502 | Haloperidol | approved | inverse agonist |
| P35462 | DRD3 | DB06216 | Asenapine | approved | antagonist |
| P35462 | DRD3 | DB06016 | Cariprazine | approved, investigational | partial agonist |
| P35462 | DRD3 | DB00363 | Clozapine | approved | antagonist |
| P35462 | DRD3 | DB09289 | Tianeptine | investigational | agonist |
| P35462 | DRD3 | DB00246 | Ziprasidone | approved | antagonist |
| P35462 | DRD3 | DB00408 | Loxapine | approved | binder |
| P35462 | DRD3 | DB09207 | AS-8112 | experimental | antagonist |
| P35462 | DRD3 | DB00988 | Dopamine | approved | agonist |
| P35462 | DRD3 | DB01403 | Methotrimeprazine | approved, investigational | antagonist |
| P35462 | DRD3 | DB06148 | Mianserin | approved, investigational | binder |
| P35462 | DRD3 | DB06477 | Sumanirole | investigational | |
| P35462 | DRD3 | DB00334 | Olanzapine | approved, investigational | antagonist |
| P35462 | DRD3 | DB00248 | Cabergoline | approved | agonist |
| P35462 | DRD3 | DB09286 | Pipamperone | investigational | |
| P35462 | DRD3 | DB06454 | Sarizotan | investigational | ligand |
| P35462 | DRD3 | DB11274 | Dihydro-alpha-ergocryptine | approved | partial agonist |
| P35462 | DRD3 | DB01267 | Paliperidone | approved | antagonist |
Related Diseases to DRD3 |
| Previous studies relating to the alternative splicing of DRD3 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| DRD3 | 9457173 | Dopamine receptors: from structure to function. | The diverse physiological actions of dopamine are mediated by at least five distinct G protein-coupled receptor subtypes. Two D1-like receptor subtypes (D1 and D5) couple to the G protein Gs and activate adenylyl cyclase. The other receptor subtypes belong to the D2-like subfamily (D2, D3, and D4) and are prototypic of G protein-coupled receptors that inhibit adenylyl cyclase and activate K+ channels. The genes for the D1 and D5 receptors are intronless, but pseudogenes of the D5 exist. The D2 and D3 receptors vary in certain tissues and species as a result of alternative splicing, and the human D4 receptor gene exhibits extensive polymorphic variation. In the central nervous system, dopamine receptors are widely expressed because they are involved in the control of locomotion, cognition, emotion, and affect as well as neuroendocrine secretion. In the periphery, dopamine receptors are present more prominently in kidney, vasculature, and pituitary, where they affect mainly sodium homeostasis, vascular tone, and hormone secretion. Numerous genetic linkage analysis studies have failed so far to reveal unequivocal evidence for the involvement of one of these receptors in the etiology of various central nervous system disorders. However, targeted deletion of several of these dopamine receptor genes in mice should provide valuable information about their physiological functions. | D006973 | Hypertension |
Clinically important variants in DRD3 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |