Protein:ESR2 |
Protein Summary |
 Gene summary |
| Gene name: ESR2 | ASpdb.0 ID: 2100 | Gene | Gene symbol | ESR2 | Gene ID | 2100 |
| Gene name | estrogen receptor 2 |
| Synonyms | ER-BETA|ESR-BETA|ESRB|ESTRB|Erb|NR3A2|ODG8 |
| Cytomap | 14q23.2-q23.3 |
| Type of gene | protein-coding |
| Description | estrogen receptor betaestrogen receptor beta 2estrogen receptor beta 4nuclear receptor subfamily 3 group A member 2oestrogen receptor beta |
| Modification date | 20240411 |
| UniProtAcc | Q92731 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | ESR2 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 15345745 |
| Gene | ESR2 | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 15345745 |
| Gene | ESR2 | GO:0004879 | nuclear receptor activity | 19126643 |
| Gene | ESR2 | GO:0005634 | nucleus | 19126643|20074560 |
| Gene | ESR2 | GO:0005654 | nucleoplasm | - |
| Gene | ESR2 | GO:0005739 | mitochondrion | 15024130 |
| Gene | ESR2 | GO:0030284 | nuclear estrogen receptor activity | 19126643 |
| Gene | ESR2 | GO:0034056 | estrogen response element binding | 15345745|19126643 |
| Gene | ESR2 | GO:0043231 | intracellular membrane-bounded organelle | - |
| Gene | ESR2 | GO:0045893 | positive regulation of DNA-templated transcription | 20074560 |
| Gene | ESR2 | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 10681512 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q92731-1 | Q92731-1_2fsz_B.pdb | 2FSZ | X-ray | 2.2 | B | 260 | 501 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q92731 | ESR2 | Q92731-1 | Q92731-2 | 530 | 495 | 469 | 530 | Substitution | SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ | RAEKASQTLTSFGMKMETLLPEATMEQ | 469 | 495 |
| Q92731 | ESR2 | Q92731-1 | Q92731-3 | 530 | 323 | 319 | 323 | Substitution | FVELS | MRGNA | 319 | 323 |
| Q92731 | ESR2 | Q92731-1 | Q92731-3 | 530 | 323 | 324 | 530 | Deletion | none | none | 323 | 323 |
| Q92731 | ESR2 | Q92731-1 | Q92731-4 | 530 | 513 | 469 | 530 | Substitution | SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ | SSLSLSWRLFMLREASCHGVRQTPGGAHMSVSRSRSFEACQQPRE | 469 | 513 |
| Q92731 | ESR2 | Q92731-1 | Q92731-5 | 530 | 481 | 469 | 530 | Substitution | SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ | RWGEKQFIHLKLS | 469 | 481 |
| Q92731 | ESR2 | Q92731-1 | Q92731-6 | 530 | 472 | 469 | 530 | Substitution | SNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ | RYAP | 469 | 472 |
| Q92731 | ESR2 | Q92731-1 | Q92731-7 | 530 | 439 | 319 | 409 | Deletion | none | none | 318 | 318 |
| Q92731 | ESR2 | Q92731-1 | Q92731-8 | 530 | 375 | 365 | 375 | Substitution | DEGKCVEGILE | YVPSGHSDPGC | 365 | 375 |
| Q92731 | ESR2 | Q92731-1 | Q92731-8 | 530 | 375 | 376 | 530 | Deletion | none | none | 375 | 375 |
| Q92731 | ESR2 | Q92731-1 | Q92731-9 | 530 | 474 | 469 | 474 | Substitution | SNKGME | RSCVYK | 469 | 474 |
| Q92731 | ESR2 | Q92731-1 | Q92731-9 | 530 | 474 | 475 | 530 | Deletion | none | none | 474 | 474 |
| Multiple sequence alignment of our canonical and alternatively spliced ESR2 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of ESR2 |
| UniProt-id | ENSG | ENST | ENSP |
| Q92731-1 | ENSG00000140009.19 | ENST00000341099.6 | ENSP00000343925.4 |
| Q92731-2 | ENSG00000140009.19 | ENST00000353772.7 | ENSP00000335551.4 |
| Q92731-2 | ENSG00000140009.19 | ENST00000358599.9 | ENSP00000351412.5 |
| Q92731-2 | ENSG00000140009.19 | ENST00000554572.5 | ENSP00000450699.1 |
| Q92731-3 | ENSG00000140009.19 | ENST00000344288.10 | ENSP00000345616.6 |
| Q92731-5 | ENSG00000140009.19 | ENST00000555278.5 | ENSP00000450488.1 |
| Q92731-6 | ENSG00000140009.19 | ENST00000557772.5 | ENSP00000451582.1 |
| Q92731-7 | ENSG00000140009.19 | ENST00000267525.10 | ENSP00000267525.6 |
| Q92731-9 | ENSG00000140009.19 | ENST00000553796.5 | ENSP00000452426.1 |
| UniProt-id | NM ID | NP ID |
| Q92731-1 | NM_001437.2 | NP_001428.1 |
| Q92731-2 | NM_001040275.1 | NP_001035365.1 |
| Q92731-2 | NM_001291712.1 | NP_001278641.1 |
| Q92731-2 | NM_001291723.1 | NP_001278652.1 |
| Q92731-5 | NM_001214902.1 | NP_001201831.1 |
| Q92731-7 | NM_001271877.1 | NP_001258806.1 |
| Q92731-9 | NM_001271876.1 | NP_001258805.1 |
| Amino acid sequences of our canonical and alternatively spliced ESR2 |
| accession_id | Protein sequence |
| Q92731-1 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
| Q92731-2 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
| Q92731-3 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL |
| Q92731-4 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
| Q92731-5 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
| Q92731-6 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
| Q92731-7 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQQ |
| Q92731-8 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL |
| Q92731-9 | MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLV VHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVL TLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| ESR2 (go to UniProt):Q92731 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=469;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=319;End=323 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=324;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=469;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=469;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=469;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=319;End=409 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=365;End=375 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=376;End=530 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=469;End=474 |
| Q92731 | Domain | 264 | 498 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=475;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=469;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=324;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=469;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=469;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=469;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=376;End=530 |
| Q92731 | Region | 507 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=475;End=530 |
Gene Isoform Structures and Expression Levels for ESR2 |
| Gene structures of our canonical and alternative spliced genes of ESR2 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q92731-1 |
| 3D view using mol* of Q92731-2 |
| 3D view using mol* of Q92731-3 |
| 3D view using mol* of Q92731-4 |
| 3D view using mol* of Q92731-5 |
| 3D view using mol* of Q92731-6 |
| 3D view using mol* of Q92731-7 |
| 3D view using mol* of Q92731-8 |
| 3D view using mol* of Q92731-9 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q92731-1 |
 |
| pLDDT distribution across the protein length of Q92731-2 |
 |
| pLDDT distribution across the protein length of Q92731-3 |
 |
| pLDDT distribution across the protein length of Q92731-4 |
 |
| pLDDT distribution across the protein length of Q92731-5 |
 |
| pLDDT distribution across the protein length of Q92731-6 |
 |
| pLDDT distribution across the protein length of Q92731-7 |
 |
| pLDDT distribution across the protein length of Q92731-8 |
 |
| pLDDT distribution across the protein length of Q92731-9 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q92731-1 |
 |
| Ramachandran plot of Q92731-2 |
 |
| Ramachandran plot of Q92731-3 |
 |
| Ramachandran plot of Q92731-5 |
 |
| Ramachandran plot of Q92731-8 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q92731-1 | 1.344 | 132 | 1.45 | 162.582 | 0.18 | 0.983 | 1.214 | 4.707 | 0.244 | 19.277 | 3.666 | 280,295,298,299,301,302,305,335,336,339,340,343,34 6,354,356,357,362,373,376,377,380,472,475,476,491 |
| Q92731-2 | 1.299 | 173 | 1.393 | 290.178 | 0.291 | 0.947 | 1.199 | 4.068 | 0.353 | 11.524 | 0.801 | 298,299,301,302,303,305,306,335,336,339,340,342,34 3,346,354,356,362,367,370,373,376,377,379,380,468, 469,472,473,476,477,480,481,483,484,487 |
| Q92731-3 | 0.761 | 58 | 0.721 | 253.134 | 0.724 | 0.602 | 0.844 | 0.191 | 1.092 | 0.175 | 0.614 | 159,160,161,162,164,213,215,217,218,219,221,222,22 3,224,225,226,227 |
| Q92731-4 | 1.352 | 101 | 1.465 | 124.852 | 0.235 | 0.981 | 1.244 | 5.746 | 0.196 | 29.329 | 0.543 | 298,301,302,305,335,336,339,340,342,343,346,354,35 6,373,376,377,380,472,475,479 |
| Q92731-5 | 1.206 | 140 | 1.289 | 265.482 | 0.397 | 0.848 | 1.077 | 2.84 | 0.489 | 5.805 | 1.568 | 295,298,299,301,302,303,305,306,335,336,339,340,34 3,346,356,362,367,373,376,377,380,469,472,473,475, 476,480 |
| Q92731-6 | 1.096 | 82 | 1.154 | 290.178 | 0.464 | 0.805 | 1.086 | 2.301 | 0.552 | 4.167 | 4.008 | 295,298,301,302,305,335,336,339,340,343,346,356,37 3,376,377,379,380,468,469,471 |
| Q92731-7 | 0.965 | 88 | 0.931 | 223.979 | 0.537 | 0.714 | 0.981 | 0.601 | 1.163 | 0.516 | 0.745 | 256,257,258,259,260,261,313,314,315,316,317,318,31 9,320,321,330,333,334,337,338 |
| Q92731-8 | 0.994 | 78 | 1.03 | 254.849 | 0.612 | 0.723 | 0.907 | 0.962 | 0.717 | 1.342 | 0.924 | 272,273,276,277,278,279,280,301,305,309,312,338,33 9,341,342,345,346 |
| Q92731-9 | 1.079 | 91 | 0.865 | 155.036 | 0.368 | 0.867 | 1.23 | 0.536 | 1.692 | 0.317 | 1.109 | 276,277,278,279,280,301,305,308,309,338,339,342,34 5,346,356,357,358,394,397,401 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q92731-1_Q92731-1_2fsz_B.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-2.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-3.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-4.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-5.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-6.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-7.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-8.pdb |
| 3D view using mol* of Q92731-1_2fsz_B_Q92731-9.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92731-1_Q92731-2.pdb |
| 3D view using mol* of Q92731-1_Q92731-3.pdb |
| 3D view using mol* of Q92731-1_Q92731-4.pdb |
| 3D view using mol* of Q92731-1_Q92731-5.pdb |
| 3D view using mol* of Q92731-1_Q92731-6.pdb |
| 3D view using mol* of Q92731-1_Q92731-7.pdb |
| 3D view using mol* of Q92731-1_Q92731-8.pdb |
| 3D view using mol* of Q92731-1_Q92731-9.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-2.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-3.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-4.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-5.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-6.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-7.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-8.png |
 < |
| ./stats/secondary_structure/figure/Q92731-1_vs_Q92731-9.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q92731-1_vs_Q92731-2.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-3.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-4.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-5.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-6.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-7.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-8.png |
 < |
| ./stats/relative_asa/Q92731-1_vs_Q92731-9.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to ESR2 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| Q92731 | ESR2 | DB05052 | MF101 | investigational | |
| Q92731 | ESR2 | DB13952 | Estradiol acetate | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB07036 | (3aS,4R,9bR)-2,2-difluoro-4-(4-hydroxyphenyl)-6-(methoxymethyl)-1,2,3,3a,4,9b-hexahydrocyclopenta[c]chromen-8-ol | experimental | |
| Q92731 | ESR2 | DB03467 | Naringenin | experimental | partial agonist |
| Q92731 | ESR2 | DB05966 | TAS-108 | investigational | |
| Q92731 | ESR2 | DB06401 | Bazedoxifene | approved, investigational | |
| Q92731 | ESR2 | DB14641 | Estriol tripropionate | experimental | |
| Q92731 | ESR2 | DB02983 | Para-Mercury-Benzenesulfonic Acid | experimental | |
| Q92731 | ESR2 | DB07236 | 3-(6-HYDROXY-NAPHTHALEN-2-YL)-BENZO[D]ISOOXAZOL-6-OL | experimental | |
| Q92731 | ESR2 | DB07119 | 1-CHLORO-6-(4-HYDROXYPHENYL)-2-NAPHTHOL | experimental | |
| Q92731 | ESR2 | DB02757 | Pyrazole | experimental | |
| Q92731 | ESR2 | DB06249 | Arzoxifene | approved, investigational | |
| Q92731 | ESR2 | DB07638 | (3AS,4R,9BR)-2,2-DIFLUORO-4-(4-HYDROXYPHENYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL | experimental | |
| Q92731 | ESR2 | DB07230 | 3-BROMO-6-HYDROXY-2-(4-HYDROXYPHENYL)-1H-INDEN-1-ONE | experimental | |
| Q92731 | ESR2 | DB07150 | 4-(4-HYDROXYPHENYL)-1-NAPHTHALDEHYDE OXIME | experimental | |
| Q92731 | ESR2 | DB06202 | Lasofoxifene | approved, investigational | agonist |
| Q92731 | ESR2 | DB07702 | 17alpha-Estriol | experimental | |
| Q92731 | ESR2 | DB03860 | ICI-164384 | experimental | |
| Q92731 | ESR2 | DB06832 | Prinaberel | investigational | |
| Q92731 | ESR2 | DB04574 | Estrone sulfate | approved | agonist |
| Q92731 | ESR2 | DB04573 | Estriol | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB08020 | (3AS,4R,9BR)-4-(4-HYDROXYPHENYL)-6-(METHOXYMETHYL)-1,2,3,3A,4,9B-HEXAHYDROCYCLOPENTA[C]CHROMEN-8-OL | experimental | |
| Q92731 | ESR2 | DB13956 | Estradiol valerate | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB04468 | Afimoxifene | investigational | |
| Q92731 | ESR2 | DB02746 | Phthalic Acid | experimental | |
| Q92731 | ESR2 | DB07933 | Erteberel | experimental, investigational | |
| Q92731 | ESR2 | DB06927 | [5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-YL]ACETONITRILE | experimental | |
| Q92731 | ESR2 | DB13953 | Estradiol benzoate | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB06937 | 4-(6-HYDROXY-BENZO[D]ISOXAZOL-3-YL)BENZENE-1,3-DIOL | experimental | |
| Q92731 | ESR2 | DB04216 | Quercetin | experimental, investigational | |
| Q92731 | ESR2 | DB04020 | 4-(2-{[4-{[3-(4-Chlorophenyl)Propyl]Sulfanyl}-6-(1-Piperazinyl)-1,3,5-Triazin-2-Yl]Amino}Ethyl)Phenol | experimental | |
| Q92731 | ESR2 | DB13954 | Estradiol cypionate | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB05882 | CHF 4227 | investigational | |
| Q92731 | ESR2 | DB07009 | 2-(5-HYDROXY-NAPHTHALEN-1-YL)-1,3-BENZOOXAZOL-6-OL | experimental | |
| Q92731 | ESR2 | DB07757 | (9aS)-4-bromo-9a-butyl-7-hydroxy-1,2,9,9a-tetrahydro-3H-fluoren-3-one | experimental | |
| Q92731 | ESR2 | DB03882 | 5-Alpha-Androstane-3-Beta,17beta-Diol | experimental | agonist |
| Q92731 | ESR2 | DB07032 | 2-(4-HYDROXY-PHENYL)BENZOFURAN-5-OL | experimental | |
| Q92731 | ESR2 | DB13955 | Estradiol dienanthate | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB06875 | ERB-196 | experimental | |
| Q92731 | ESR2 | DB07198 | 5-HYDROXY-2-(4-HYDROXYPHENYL)-1-BENZOFURAN-7-CARBONITRILE | experimental | |
| Q92731 | ESR2 | DB01108 | Trilostane | approved, investigational, vet_approved, withdrawn | allosteric modulator |
| Q92731 | ESR2 | DB12235 | Estetrol | approved, investigational | agonist |
| Q92731 | ESR2 | DB09535 | Octocrylene | approved, investigational | |
| Q92731 | ESR2 | DB01708 | Prasterone | approved, investigational, nutraceutical | activator |
| Q92731 | ESR2 | DB11219 | Enzacamene | approved | |
| Q92731 | ESR2 | DB01645 | Genistein | investigational | |
| Q92731 | ESR2 | DB01428 | Oxybenzone | approved, investigational | |
| Q92731 | ESR2 | DB13310 | Ormeloxifene | experimental | modulator |
| Q92731 | ESR2 | DB11674 | Equol | investigational | agonist |
| Q92731 | ESR2 | DB15690 | Fluoroestradiol F-18 | approved | binder |
| Q92731 | ESR2 | DB00783 | Estradiol | approved, investigational, vet_approved | agonist |
| Q92731 | ESR2 | DB00675 | Tamoxifen | approved | antagonist, agonist |
| Q92731 | ESR2 | DB00655 | Estrone | approved | |
| Q92731 | ESR2 | DB00481 | Raloxifene | approved, investigational | agonist |
| Q92731 | ESR2 | DB00396 | Progesterone | approved, vet_approved | agonist, downregulator |
| Q92731 | ESR2 | DB01196 | Estramustine | approved, investigational | other/unknown |
| Q92731 | ESR2 | DB01878 | Benzophenone | experimental | |
| Q92731 | ESR2 | DB00286 | Conjugated estrogens | approved | agonist |
| Q92731 | ESR2 | DB00255 | Diethylstilbestrol | approved, investigational, withdrawn | agonist |
| Q92731 | ESR2 | DB13869 | 2-Methoxy-6-{(E)-[(4-methylphenyl)imino]methyl}phenol | experimental | |
| Q92731 | ESR2 | DB09086 | Eugenol | approved |
Related Diseases to ESR2 |
| Previous studies relating to the alternative splicing of ESR2 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| ESR2 | 14674142 | [Evaluation of wild-type estrogen receptor beta and its isoforms: ER-beta/delta 5/6 i ER-beta/delta 6 in endometrial adenocarcinoma]. | Estrogen target genes play essential role among pathogenetic and prognostic factors of endometrial adenocarcinoma; and among them estrogen receptor genes. Although prevailing estrogen receptor type is ER-alpha in endometrium, transduction of signal carried by estrogens can be also mediate by ER-beta, which biological meaning relies on modulation of ER-alpha transcriptional activity. There is hypothesized that ER-beta can keep under control mitogenic activity mediating by ER-alpha. The aim of the study was qualitative and quantitative analysis of wtER-beta and ER-beta/delta 5-6, ER-beta/delta 6 isoforms in endometrial adenocarcinoma. Material used in the study included specimens obtained from 27 female: group I--normal endometrium (n = 12), group II--endometrial adenocarcinoma (n = 15). RNA was extracted from the analyzed material using phenol-chloroform method by Total RNA Prep Plus. Qualitative analysis was performed basing on RT-PCR reaction and polyacrylamide gel electrophoreses. For all RNA extracts of the samples examined RT-PCR was performed with a sequence detector ABIPRISMTM7700--Perkin-Elmer Applied Biosystems (RT: 600 C-30 min; PCR: 950 C-5 min, 40 cycles: 950 C-30s, 600 C-1 min, and 720 C-10 min) in order to determine the number of RNA copies (which corresponds to the number of cDNA copies) for wtER-beta and ER-beta/delta 5-6 and ER-beta/delta 6. Specificity of QRT-PCR reaction was determined by delimitation of melting temperature of all examined amplimers (ABI PRISM7000, Qu-antiTect SYBR Green RT-PCR Kit) and by sequence analysis using ABI PRISM377 DNA Sequencer. Wild-type of estrogen receptor beta and ER-beta/delta 5-6, ER-beta/delta 6 isoforms--coming into alternative splicing of mRNA, presented both, in proliferative endometrium and endometrial adenocarcinoma. Copy number of wtER-beta mRNA was significantly (p < 0.05, Mann-Whitney U test) lower in comparison with proliferative endometrium and correlated with decrease of ER-beta/delta 6 mRNA copy number (r = 0.85; p < 0.05). Preliminary results confirming decrease of wtER-beta, ER-beta/delta 5/6 and ER-beta/delta 6 mRNA copy number in endometrial adenocarcinoma can show their relationship with high risk of carcinogenesis. | D000230 | Adenocarcinoma |
| ESR2 | 14674142 | [Evaluation of wild-type estrogen receptor beta and its isoforms: ER-beta/delta 5/6 i ER-beta/delta 6 in endometrial adenocarcinoma]. | Estrogen target genes play essential role among pathogenetic and prognostic factors of endometrial adenocarcinoma; and among them estrogen receptor genes. Although prevailing estrogen receptor type is ER-alpha in endometrium, transduction of signal carried by estrogens can be also mediate by ER-beta, which biological meaning relies on modulation of ER-alpha transcriptional activity. There is hypothesized that ER-beta can keep under control mitogenic activity mediating by ER-alpha. The aim of the study was qualitative and quantitative analysis of wtER-beta and ER-beta/delta 5-6, ER-beta/delta 6 isoforms in endometrial adenocarcinoma. Material used in the study included specimens obtained from 27 female: group I--normal endometrium (n = 12), group II--endometrial adenocarcinoma (n = 15). RNA was extracted from the analyzed material using phenol-chloroform method by Total RNA Prep Plus. Qualitative analysis was performed basing on RT-PCR reaction and polyacrylamide gel electrophoreses. For all RNA extracts of the samples examined RT-PCR was performed with a sequence detector ABIPRISMTM7700--Perkin-Elmer Applied Biosystems (RT: 600 C-30 min; PCR: 950 C-5 min, 40 cycles: 950 C-30s, 600 C-1 min, and 720 C-10 min) in order to determine the number of RNA copies (which corresponds to the number of cDNA copies) for wtER-beta and ER-beta/delta 5-6 and ER-beta/delta 6. Specificity of QRT-PCR reaction was determined by delimitation of melting temperature of all examined amplimers (ABI PRISM7000, Qu-antiTect SYBR Green RT-PCR Kit) and by sequence analysis using ABI PRISM377 DNA Sequencer. Wild-type of estrogen receptor beta and ER-beta/delta 5-6, ER-beta/delta 6 isoforms--coming into alternative splicing of mRNA, presented both, in proliferative endometrium and endometrial adenocarcinoma. Copy number of wtER-beta mRNA was significantly (p < 0.05, Mann-Whitney U test) lower in comparison with proliferative endometrium and correlated with decrease of ER-beta/delta 6 mRNA copy number (r = 0.85; p < 0.05). Preliminary results confirming decrease of wtER-beta, ER-beta/delta 5/6 and ER-beta/delta 6 mRNA copy number in endometrial adenocarcinoma can show their relationship with high risk of carcinogenesis. | D016889 | Endometrial Neoplasms |
| ESR2 | 25956916 | Estrogen receptor beta impacts hormone-induced alternative mRNA splicing in breast cancer cells. | Estrogens play an important role in breast cancer (BC) development and progression; when the two isoforms of the estrogen receptor (ERα and ERβ) are co-expressed each of them mediate specific effects of these hormones in BC cells. ERβ has been suggested to exert an antagonist role toward the oncogenic activities of ERα, and for this reason it is considered an oncosuppressor. As clinical evidence regarding a prognostic role for this receptor subtype in hormone-responsive BC is still limited and conflicting, more knowledge is required on the biological functions of ERβ in cancer cells. We have previously described the ERβ and ERα interactomes from BC cells, identifying specific and distinct patterns of protein interactions for the two receptors. In particular, we identified factors involved in mRNA splicing and maturation as important components of both ERα and ERβ pathways. Guided by these findings, here we performed RNA sequencing to investigate in depth the differences in the early transcriptional events and RNA splicing patterns induced by estradiol in cells expressing ERα alone or ERα and ERβ. | D001943 | Breast Neoplasms |
Clinically important variants in ESR2 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
| Q92731 | Q92731-9 | ESR2 | single nucleotide variant | p.Lys474Thr | Benign |
| Q92731 | Q92731-9 | ESR2 | single nucleotide variant | p.Lys474Thr | Benign |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |