ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures
ASpdb Logo

Home

Download

Statistics

Examples

Help

Contact

Terms of Use

Center for Computational Systems Medicine
leaf

Protein Summary

leaf

AS Summary

leaf

Protein Functional Features

leaf

Gene Isoform Structures and Expression Levels

leaf

Protein Structures

leaf

pLDDT Score Distribution

leaf

Ramachandran Plot of Protein Structures

leaf

Potential Active Site Information

leaf

Protein Structure and Feature Comparision

leaf

Protein-Protein Interaction

leaf

Related Drugs

leaf

Related Diseases

leaf

Clinically Important Variants

Protein:ETS1

Protein Summary

check button Gene summary
Gene name: ETS1
ASpdb.0 ID: 2113
Gene
Gene symbol

ETS1

Gene ID

2113

Gene nameETS proto-oncogene 1, transcription factor
SynonymsETS-1|EWSR2|c-ets-1|p54
Cytomap

11q24.3

Type of geneprotein-coding
Descriptionprotein C-ets-1Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1v-ets avian erythroblastosis virus E2 oncogene homolog 1v-ets avian erythroblastosis virus E26 oncogene homolog 1
Modification date20240403
UniProtAcc

P14921


check button Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
GeneETS1

GO:0000976

transcription cis-regulatory region binding

31146003

GeneETS1

GO:0000978

RNA polymerase II cis-regulatory region sequence-specific DNA binding

12119294

GeneETS1

GO:0000981

DNA-binding transcription factor activity, RNA polymerase II-specific

21711453

GeneETS1

GO:0001222

transcription corepressor binding

10698492

GeneETS1

GO:0001228

DNA-binding transcription activator activity, RNA polymerase II-specific

15001984

GeneETS1

GO:0003700

DNA-binding transcription factor activity

10698492|11909962|15247905

GeneETS1

GO:0005634

nucleus

11909962|15247905

GeneETS1

GO:0005654

nucleoplasm

-

GeneETS1

GO:0030578

PML body organization

11909962|15247905

GeneETS1

GO:0045648

positive regulation of erythrocyte differentiation

8620536

GeneETS1

GO:0045893

positive regulation of DNA-templated transcription

10698492

GeneETS1

GO:0045944

positive regulation of transcription by RNA polymerase II

11909962|15001984|15247905

GeneETS1

GO:0050729

positive regulation of inflammatory response

21310411

GeneETS1

GO:1902895

positive regulation of miRNA transcription

21711453



AS Summary

check button Information of the canonical protein with experimentally identified structure from PDB (2023).
UniProt AccFile namePDB IDMethodResolutionChainStartEnd
P14921-1P14921-1_1gvj_B.pdb1GVJX-ray1.53B297441

check button ASpdb's canonical and alternatively spliced isoform information.
accession_idgene_namecanonical_idalternative_idcanonical_lengthalternative_lengthcanonical_startcanonical_endtypeoriginalSEQvariationSEQalternative_startalternative_end
P14921ETS1P14921-1P14921-2441354244330Deletionnonenone243243
P14921ETS1P14921-1P14921-3441485127SubstitutionMKAAVDLKPTLTIIKTEKVDLELFPSPMSYFVDSAGSSPVPYSAPRPAVVRQGPSNTYEDPRMNCGFQSNYHQQRPCYPFWDEMATQEVPTGLEHCVS171
P14921ETS1P14921-1P14921-444122528243Deletionnonenone2727
P14921ETS1P14921-1P14921-5441272262272SubstitutionDRLTQSWSSQSGQEMGKEEKQT262272
P14921ETS1P14921-1P14921-5441272273441Deletionnonenone272272

check buttonMultiple sequence alignment of our canonical and alternatively spliced ETS1

check button Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of ETS1
UniProt-idENSGENSTENSP
P14921-1ENSG00000134954.14ENST00000319397.7ENSP00000324578.5
P14921-2ENSG00000134954.14ENST00000526145.6ENSP00000433500.1
P14921-3ENSG00000134954.14ENST00000392668.8ENSP00000376436.3
P14921-4ENSG00000134954.14ENST00000535549.5ENSP00000441430.1
P14921-5ENSG00000134954.14ENST00000531611.5ENSP00000435666.1

UniProt-idNM IDNP ID
P14921-1NM_005238.3NP_005229.1
P14921-2NM_001330451.1NP_001317380.1
P14921-3NM_001143820.1NP_001137292.1
P14921-3XM_017017314.1XP_016872803.1
P14921-4NM_001162422.1NP_001155894.1

check buttonAmino acid sequences of our canonical and alternatively spliced ETS1
accession_idProtein sequence
P14921-1MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSL
KGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSS
QSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
P14921-2MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSL
KGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGSGPIQLWQFLLELLTDKSCQSFISWT
P14921-3MSYFVDSAGSSPVPYSAPRPAVVRQGPSNTYEDPRMNCGFQSNYHQQRPCYPFWDEMATQEVPTGLEHCVSDMECADVPLLTPSSKEMMS
QALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKED
VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAI
KQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNK
DKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTA
P14921-4MKAAVDLKPTLTIIKTEKVDLELFPSPGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKD
YVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYY
P14921-5MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSL
KGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEK

Protein Functional Features

check buttonMain function of this protein. (from UniProt)
ETS1 (go to UniProt):P14921

check buttonRetention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

* Minus value of BPloci means that the break pointn is located before the CDS.
- Retained protein feature among the 13 regional features.
Accession_idSubsectionStartEndFuncitonal featureSplicing information
P14921Domain51136Note=PNT;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00762Type=Deletion;Start=28;End=243
P14921DNA binding335415Note=ETS;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00237Type=Deletion;Start=273;End=441
P14921Region130243Note=Activation domain%3B required for transcription activation;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11909962;Dbxref=PMID:11909962Type=Deletion;Start=28;End=243
P14921Region304312Note=Helix HI-1;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=244;End=330
P14921Region304312Note=Helix HI-1;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=273;End=441
P14921Region323330Note=Helix HI-2;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=244;End=330
P14921Region323330Note=Helix HI-2;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=273;End=441
P14921Region418422Note=Helix H4;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=273;End=441
P14921Region426432Note=Helix H5;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P27577Type=Deletion;Start=273;End=441


Gene Isoform Structures and Expression Levels for ETS1

check buttonGene structures of our canonical and alternative spliced genes of ETS1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
gene isoform structure of ETS1

check button Expression levels of gene isoforms across GTEx.
gtex expression

check button Expression levels of gene isoforms across TCGA.
tcga expression


Protein Structures

check button PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.
3D view using mol* of P14921-1
3D view using mol* of P14921-2
3D view using mol* of P14921-3
3D view using mol* of P14921-4
3D view using mol* of P14921-5


pLDDT Score Distribution

check button pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.
pLDDT distribution across the protein length of P14921-1
all structure
pLDDT distribution across the protein length of P14921-2
all structure
pLDDT distribution across the protein length of P14921-3
all structure
pLDDT distribution across the protein length of P14921-4
all structure
pLDDT distribution across the protein length of P14921-5
all structure


Ramachandran Plot of Protein Structures


check button Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.
Ramachandran plot of P14921-1
all structure
Ramachandran plot of P14921-4
all structure

Potential Active Site Information


check button The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.
UniProt-idSite scoreSizeD scoreVolumeExposureEnclosureContactPhobicPhilicBalanceDon/AccResidues
P14921-11.029971.071263.0810.5220.7020.9761.0390.8451.2291.261305,307,308,309,311,312,313,314,315,316,318,319,32
0,322,325,346,347,348,424,432,433
P14921-21.0691031.137272.3420.6390.6980.8921.260.6831.8470.94545,48,49,51,52,87,88,124,229,230,232,235,236,237,2
38,239,240,249,250,251,309,312,314,329,330,331,334

P14921-31.0462761.101702.1210.5740.6920.9221.1320.781.4522.00478,80,81,82,83,85,86,88,89,90,92,93,94,96,132,133,
134,135,154,158,159,161,162,163,164,165,166,167,16
8,170,171,174,175,178,179,364,365,366,369,370,372,
373,374,375,376,380,382,383,464,465,466,468
P14921-41.0581541.116279.5450.5230.7020.9571.2480.7531.6570.75714,15,16,17,18,19,20,21,22,23,24,116,118,119,120,1
21,159,163,168,172,173,175,176,179,180,183
P14921-50.784650.713180.4180.6930.5870.7980.0381.2170.0311.87750,53,54,56,57,60,66,67,68,71,128,131,132,135,136,
138,139,140,141

Protein Structure and Feature Comparision


check button Protein Structure Comparision Using Template Modeling Scores (TM-score).
all structure

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)
3D view using mol* of P14921-1_P14921-1_1gvj_B.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of P14921-1_1gvj_B_P14921-2.pdb
3D view using mol* of P14921-1_1gvj_B_P14921-3.pdb
3D view using mol* of P14921-1_1gvj_B_P14921-4.pdb
3D view using mol* of P14921-1_1gvj_B_P14921-5.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of P14921-1_P14921-2.pdb
3D view using mol* of P14921-1_P14921-3.pdb
3D view using mol* of P14921-1_P14921-4.pdb
3D view using mol* of P14921-1_P14921-5.pdb

check button Protein Feature Comparison of the protein sequendary structures among the protiens.
./stats/secondary_structure/figure/P14921-1_vs_P14921-2.png
all structure<
./stats/secondary_structure/figure/P14921-1_vs_P14921-3.png
all structure<
./stats/secondary_structure/figure/P14921-1_vs_P14921-4.png
all structure<
./stats/secondary_structure/figure/P14921-1_vs_P14921-5.png
all structure<

check button Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.
./stats/relative_asa/P14921-1_vs_P14921-2.png
all structure<
./stats/relative_asa/P14921-1_vs_P14921-3.png
all structure<
./stats/relative_asa/P14921-1_vs_P14921-4.png
all structure<
./stats/relative_asa/P14921-1_vs_P14921-5.png
all structure<


Protein-Protein Interaction


check button Interactors from UniProt.
Accession_idSubsectionStartEndFuncitonal featureSplicing information


check button Interactors from STRING.
Gene nameInteractors


Related Drugs to ETS1


check button Drugs targeting this gene/protein.
(DrugBank)
UniProt accessionGene nameDrugBank IDDrug nameDrug groupActions

Related Diseases to ETS1


check button Previous studies relating to the alternative splicing of ETS1 and disease information from the MeSH term (PubMed)
GenePMIDTitleAbstractMeSH IDMeSH term
ETS18231246Quantitative and qualitative variation of ETS-1 transcripts in hematologic malignancies.The ETS family proteins have a conserved DNA-binding domain and act as transcription factors. Three domains have been recently defined in human ETS-1 proteins and their role could depend upon the nature of alternative transcripts according to whether they possess or lack DNA binding and/or transcriptional activation domain and also point mutation that could affect these important domains. Expression of ETS-1 gene is very complex and is controlled at several levels: the initiation of transcription, alternative splicing, post-translational modification, and protein stability. As a selection apparently exists for ETS-1 gene activation in hematopoietic cells, we investigated a relation between quantitative and qualitative ETS-1 expression and leukemogenesis. Using Northern blot, polymerase chain reaction (PCR), and single strand conformation polymorphism (SSCP) methods, we analyzed quantitative and qualitative ETS-1 expression in a variety of hematological pathologies and cell lines of different origin. Two ETS-1 transcripts of 6.8 and 2.7 kb, resulting from differential polyadenylation site utilization and exhibiting different stability, were observed. We identified, in a great number of patients, the four alternative ETS-1 products, but the relative extent significance of the four transcripts was very different from one patient to another. A non-conservative mutation observed in one case of T-cell acute lymphoblastic leukemia (T-ALL) and in the ETS-1 transactivation domain raised the question of suppressor activity for some ETS-1 products, as it is now known that activators and repressors can be encoded by the same gene and consistently co-expressed in vivo.D007938Leukemia
ETS112850290Ets-1 activates parathyroid hormone-related protein gene expression in tumorigenic breast epithelial cells.Parathyroid hormone-related protein (PTHrP) is produced by many tumors not associated with humoral hypercalcemia, including breast cancers. In this study, we used three human immortalized mammary epithelial cell lines that differ in tumorigenicity and PTHrP expression. Using RT-PCR we investigated 5' and 3' alternative splicing of PTHrP transcripts and promoter usage in the lines. Increased levels of P3-derived transcripts and the 1-139 mRNA isoform were observed in the most tumorigenic cell line. Transient transfection experiments identified elements close to P3 promoter that appeared to account for a portion of differential PTHrP expression among the three cell lines. Using site-directed mutagenesis, a previously described Ets-1/Sp1 binding site upstream of P3 was determined to be crucial for full activity of this promoter. RT-PCR and western blot evaluation of Ets family member expression found that Ese-1 was present in all three lines, but that appreciable levels of Ets-1 protein were present exclusively in the most tumorigenic line. Cotransfection of Ets-1 expression vectors activated PTHrP reporter constructs in the most tumorigenic line but not in the other cell lines. These findings suggest a potential mechanism by which PTHrP transcription may be regulated as a consequence of events that promote tumorigenic behavior in breast epithelial cells.D001943Breast Neoplasms
ETS112850290Ets-1 activates parathyroid hormone-related protein gene expression in tumorigenic breast epithelial cells.Parathyroid hormone-related protein (PTHrP) is produced by many tumors not associated with humoral hypercalcemia, including breast cancers. In this study, we used three human immortalized mammary epithelial cell lines that differ in tumorigenicity and PTHrP expression. Using RT-PCR we investigated 5' and 3' alternative splicing of PTHrP transcripts and promoter usage in the lines. Increased levels of P3-derived transcripts and the 1-139 mRNA isoform were observed in the most tumorigenic cell line. Transient transfection experiments identified elements close to P3 promoter that appeared to account for a portion of differential PTHrP expression among the three cell lines. Using site-directed mutagenesis, a previously described Ets-1/Sp1 binding site upstream of P3 was determined to be crucial for full activity of this promoter. RT-PCR and western blot evaluation of Ets family member expression found that Ese-1 was present in all three lines, but that appreciable levels of Ets-1 protein were present exclusively in the most tumorigenic line. Cotransfection of Ets-1 expression vectors activated PTHrP reporter constructs in the most tumorigenic line but not in the other cell lines. These findings suggest a potential mechanism by which PTHrP transcription may be regulated as a consequence of events that promote tumorigenic behavior in breast epithelial cells.D002471Cell Transformation, Neoplastic
ETS119377509Ets-1 p27: a novel Ets-1 isoform with dominant-negative effects on the transcriptional properties and the subcellular localization of Ets-1 p51.The transcription factor Ets-1 is implicated in various physiological processes and invasive pathologies. We identified a novel variant of ets-1, ets-1Delta(III-VI), resulting from the alternative splicing of exons III to VI. This variant encodes a 27 kDa isoform, named Ets-1 p27. Ets-1 p27 lacks the threonine-38 residue, the Pointed domain and the transactivation domain, all of which are required for the transactivation of Ets-1 target genes. Both inhibitory domains surrounding the DNA-binding domain are conserved, suggesting that Ets-1 p27, like the full-length Ets-1 p51 isoform, is autoinhibited for DNA binding. We showed that Ets-1 p27 binds DNA in the same way as Ets-1 p51 does and that it acts both at a transcriptional and a subcellular localization level, thereby constituting a dual-acting dominant negative of Ets-1 p51. Ets-1 p27 blocks Ets-1 p51-mediated transactivation of target genes and induces the translocation of Ets-1 p51 from the nucleus to the cytoplasm. Furthermore, Ets-1 p27 overexpression represses the tumor properties of MDA-MB-231 mammary carcinoma cells in correlation with the known implication of Ets-1 in various cellular mechanisms. Thus the dual-acting dominant-negative function of Ets-1 p27 gives to the Ets-1 p27/Ets-1 p51 ratio a determining effect on cell fate.D000230Adenocarcinoma
ETS119377509Ets-1 p27: a novel Ets-1 isoform with dominant-negative effects on the transcriptional properties and the subcellular localization of Ets-1 p51.The transcription factor Ets-1 is implicated in various physiological processes and invasive pathologies. We identified a novel variant of ets-1, ets-1Delta(III-VI), resulting from the alternative splicing of exons III to VI. This variant encodes a 27 kDa isoform, named Ets-1 p27. Ets-1 p27 lacks the threonine-38 residue, the Pointed domain and the transactivation domain, all of which are required for the transactivation of Ets-1 target genes. Both inhibitory domains surrounding the DNA-binding domain are conserved, suggesting that Ets-1 p27, like the full-length Ets-1 p51 isoform, is autoinhibited for DNA binding. We showed that Ets-1 p27 binds DNA in the same way as Ets-1 p51 does and that it acts both at a transcriptional and a subcellular localization level, thereby constituting a dual-acting dominant negative of Ets-1 p51. Ets-1 p27 blocks Ets-1 p51-mediated transactivation of target genes and induces the translocation of Ets-1 p51 from the nucleus to the cytoplasm. Furthermore, Ets-1 p27 overexpression represses the tumor properties of MDA-MB-231 mammary carcinoma cells in correlation with the known implication of Ets-1 in various cellular mechanisms. Thus the dual-acting dominant-negative function of Ets-1 p27 gives to the Ets-1 p27/Ets-1 p51 ratio a determining effect on cell fate.D001859Bone Neoplasms
ETS119377509Ets-1 p27: a novel Ets-1 isoform with dominant-negative effects on the transcriptional properties and the subcellular localization of Ets-1 p51.The transcription factor Ets-1 is implicated in various physiological processes and invasive pathologies. We identified a novel variant of ets-1, ets-1Delta(III-VI), resulting from the alternative splicing of exons III to VI. This variant encodes a 27 kDa isoform, named Ets-1 p27. Ets-1 p27 lacks the threonine-38 residue, the Pointed domain and the transactivation domain, all of which are required for the transactivation of Ets-1 target genes. Both inhibitory domains surrounding the DNA-binding domain are conserved, suggesting that Ets-1 p27, like the full-length Ets-1 p51 isoform, is autoinhibited for DNA binding. We showed that Ets-1 p27 binds DNA in the same way as Ets-1 p51 does and that it acts both at a transcriptional and a subcellular localization level, thereby constituting a dual-acting dominant negative of Ets-1 p51. Ets-1 p27 blocks Ets-1 p51-mediated transactivation of target genes and induces the translocation of Ets-1 p51 from the nucleus to the cytoplasm. Furthermore, Ets-1 p27 overexpression represses the tumor properties of MDA-MB-231 mammary carcinoma cells in correlation with the known implication of Ets-1 in various cellular mechanisms. Thus the dual-acting dominant-negative function of Ets-1 p27 gives to the Ets-1 p27/Ets-1 p51 ratio a determining effect on cell fate.D001943Breast Neoplasms
ETS119377509Ets-1 p27: a novel Ets-1 isoform with dominant-negative effects on the transcriptional properties and the subcellular localization of Ets-1 p51.The transcription factor Ets-1 is implicated in various physiological processes and invasive pathologies. We identified a novel variant of ets-1, ets-1Delta(III-VI), resulting from the alternative splicing of exons III to VI. This variant encodes a 27 kDa isoform, named Ets-1 p27. Ets-1 p27 lacks the threonine-38 residue, the Pointed domain and the transactivation domain, all of which are required for the transactivation of Ets-1 target genes. Both inhibitory domains surrounding the DNA-binding domain are conserved, suggesting that Ets-1 p27, like the full-length Ets-1 p51 isoform, is autoinhibited for DNA binding. We showed that Ets-1 p27 binds DNA in the same way as Ets-1 p51 does and that it acts both at a transcriptional and a subcellular localization level, thereby constituting a dual-acting dominant negative of Ets-1 p51. Ets-1 p27 blocks Ets-1 p51-mediated transactivation of target genes and induces the translocation of Ets-1 p51 from the nucleus to the cytoplasm. Furthermore, Ets-1 p27 overexpression represses the tumor properties of MDA-MB-231 mammary carcinoma cells in correlation with the known implication of Ets-1 in various cellular mechanisms. Thus the dual-acting dominant-negative function of Ets-1 p27 gives to the Ets-1 p27/Ets-1 p51 ratio a determining effect on cell fate.D012516Osteosarcoma


Clinically important variants in ETS1


check button (ClinVar, 04/20/2024)
accession_iduniprot_idgene_nameTypeVariantClinical_significance