Protein:FCGR2B |
Protein Summary |
Gene summary |
| Gene name: FCGR2B | ASpdb.0 ID: 2213 | Gene | Gene symbol | FCGR2B | Gene ID | 2213 |
| Gene name | Fc gamma receptor IIb |
| Synonyms | CD32|CD32B|FCG2|FCGR2|FCGR2C|FcGRIIB|FcRII-c|FcgammaRIIb|IGFR2 |
| Cytomap | 1q23.3 |
| Type of gene | protein-coding |
| Description | low affinity immunoglobulin gamma Fc region receptor II-bCDw32Fc fragment of IgG receptor IIbFc fragment of IgG, low affinity II, receptor for (CD32)Fc fragment of IgG, low affinity IIb, receptor (CD32)Fc fragment of IgG, low affinity IIb, receptor f |
| Modification date | 20240310 |
| UniProtAcc | P31994 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | FCGR2B | GO:0002252 | immune effector process | 2142460 |
| Gene | FCGR2B | GO:0005886 | plasma membrane | 2142460|23921129 |
| Gene | FCGR2B | GO:0006898 | receptor-mediated endocytosis | 2142460 |
| Gene | FCGR2B | GO:0006909 | phagocytosis | 2142460 |
| Gene | FCGR2B | GO:0019772 | low-affinity IgG receptor activity | 2142460 |
| Gene | FCGR2B | GO:0019864 | IgG binding | 2142460 |
| Gene | FCGR2B | GO:0038094 | Fc-gamma receptor signaling pathway | 2142460 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P31994-1 | P31994-1_2fcb_A.pdb | 2FCB | X-ray | 1.74 | A | 46 | 217 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P31994 | FCGR2B | P31994-1 | P31994-2 | 310 | 291 | 254 | 272 | Deletion | none | none | 253 | 253 |
| P31994 | FCGR2B | P31994-1 | P31994-3 | 310 | 303 | 39 | 45 | Deletion | none | none | 38 | 38 |
| P31994 | FCGR2B | P31994-1 | P31994-4 | 310 | 309 | 46 | 46 | Deletion | none | none | 45 | 45 |
| P31994 | FCGR2B | P31994-1 | P31994-5 | 310 | 290 | 46 | 46 | Deletion | none | none | 45 | 45 |
| P31994 | FCGR2B | P31994-1 | P31994-5 | 310 | 290 | 254 | 272 | Deletion | none | none | 252 | 252 |
Multiple sequence alignment of our canonical and alternatively spliced FCGR2B |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FCGR2B |
| UniProt-id | ENSG | ENST | ENSP |
| P31994-1 | ENSG00000072694.22 | ENST00000358671.10 | ENSP00000351497.5 |
| P31994-2 | ENSG00000072694.22 | ENST00000236937.13 | ENSP00000236937.9 |
| P31994-3 | ENSG00000072694.22 | ENST00000367961.8 | ENSP00000356938.4 |
| UniProt-id | NM ID | NP ID |
| P31994-1 | NM_004001.4 | NP_003992.3 |
| P31994-2 | NM_001002274.2 | NP_001002274.1 |
| P31994-3 | NM_001190828.1 | NP_001177757.1 |
| P31994-4 | NM_001002275.2 | NP_001002275.1 |
| P31994-5 | NM_001002273.2 | NP_001002273.1 |
Amino acid sequences of our canonical and alternatively spliced FCGR2B |
| accession_id | Protein sequence |
| P31994-1 | MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNL IPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPE |
| P31994-2 | MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNL IPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANPTNPDEADKVGAENT |
| P31994-3 | MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQP SYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQAN HSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTN |
| P31994-4 | MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLI PTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNF SIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEK |
| P31994-5 | MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLI PTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNF SIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANPTNPDEADKVGAENTI |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| FCGR2B (go to UniProt):P31994 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P31994 | Topological domain | 43 | 217 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=39;End=45 |
| P31994 | Topological domain | 43 | 217 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=46;End=46 |
| P31994 | Topological domain | 43 | 217 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=46;End=46 |
| P31994 | Topological domain | 241 | 310 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=254;End=272 |
| P31994 | Topological domain | 241 | 310 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=254;End=272 |
Gene Isoform Structures and Expression Levels for FCGR2B |
Gene structures of our canonical and alternative spliced genes of FCGR2B* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P31994-1 |
| 3D view using mol* of P31994-2 |
| 3D view using mol* of P31994-3 |
| 3D view using mol* of P31994-4 |
| 3D view using mol* of P31994-5 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P31994-1 |
![]() |
| Ramachandran plot of P31994-4 |
![]() |
| Ramachandran plot of P31994-5 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P31994-1 | 0.747 | 60 | 0.704 | 117.306 | 0.695 | 0.567 | 0.77 | 0.14 | 1.117 | 0.125 | 0.576 | 54,55,56,58,61,65,66,67,68,136,151,152,153,154,157 ,158,159,160,177,179 |
| P31994-2 | 0.705 | 36 | 0.597 | 75.803 | 0.538 | 0.696 | 1.033 | 0.558 | 1.179 | 0.474 | 0.826 | 54,56,58,61,64,65,66,67,102,136,151,153,157
|
| P31994-3 | 0.751 | 60 | 0.719 | 125.195 | 0.71 | 0.573 | 0.74 | 0.279 | 1.083 | 0.257 | 0.453 | 49,51,54,57,58,59,95,129,144,145,146,147,150,151,1 52,153,170,172 |
| P31994-4 | 0.728 | 46 | 0.628 | 80.262 | 0.586 | 0.644 | 0.98 | 0.497 | 1.215 | 0.409 | 0.715 | 69,70,71,72,73,74,75,76,77,78,79,81,96,114,116,117 |
| P31994-5 | 0.789 | 31 | 0.836 | 140.287 | 0.696 | 0.623 | 0.864 | 1.954 | 0.188 | 10.372 | 7.953 | 25,28,29,32,33,36,233,234,237,238,241,242
|
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P31994-1_P31994-1_2fcb_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P31994-1_2fcb_A_P31994-2.pdb |
| 3D view using mol* of P31994-1_2fcb_A_P31994-3.pdb |
| 3D view using mol* of P31994-1_2fcb_A_P31994-4.pdb |
| 3D view using mol* of P31994-1_2fcb_A_P31994-5.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P31994-1_P31994-2.pdb |
| 3D view using mol* of P31994-1_P31994-3.pdb |
| 3D view using mol* of P31994-1_P31994-4.pdb |
| 3D view using mol* of P31994-1_P31994-5.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P31994-1_vs_P31994-2.png |
< |
| ./stats/relative_asa/P31994-1_vs_P31994-3.png |
< |
| ./stats/relative_asa/P31994-1_vs_P31994-4.png |
< |
| ./stats/relative_asa/P31994-1_vs_P31994-5.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to FCGR2B |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P31994 | FCGR2B | DB00112 | Bevacizumab | approved, investigational | |
| P31994 | FCGR2B | DB00005 | Etanercept | approved, investigational | ligand |
| P31994 | FCGR2B | DB00081 | Tositumomab | approved, investigational | |
| P31994 | FCGR2B | DB00028 | Human immunoglobulin G | approved, investigational | antagonist |
| P31994 | FCGR2B | DB00098 | Antithymocyte immunoglobulin (rabbit) | approved | |
| P31994 | FCGR2B | DB00110 | Palivizumab | approved, investigational | |
| P31994 | FCGR2B | DB00054 | Abciximab | approved | |
| P31994 | FCGR2B | DB00111 | Daclizumab | investigational, withdrawn | |
| P31994 | FCGR2B | DB11767 | Sarilumab | approved, investigational | unknown |
| P31994 | FCGR2B | DB00087 | Alemtuzumab | approved, investigational | binder |
Related Diseases to FCGR2B |
Previous studies relating to the alternative splicing of FCGR2B and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| FCGR2B | 15459183 | CD72 polymorphisms associated with alternative splicing modify susceptibility to human systemic lupus erythematosus through epistatic interaction with FCGR2B. | We previously reported association of FCGR2B-Ile232Thr with systemic lupus erythematosus (SLE) in three Asian populations. Because polymorphism of CD72, another inhibitory receptor of B cells, was associated with murine SLE, we identified human CD72 polymorphisms, tested their association with SLE and examined genetic interaction with FCGR2B in the Japanese (160 SLE, 277 controls), Thais (87 SLE, 187 controls) and Caucasians (94 families containing SLE members). Four polymorphisms and six rare variations were detected. The former constituted two major haplotypes that contained one or two repeats of 13 nucleotides in intron 8 (designated as *1 and *2, respectively). Although association with susceptibility to SLE was not detected, the *1 allele was significantly associated with nephritis among the Japanese patients (P=0.024). RT-PCR identified a novel alternatively spliced (AS) transcript that was expressed at the protein level in COS-7 transfectants. The ratio of AS/common isoforms was strikingly increased in individuals with *2/*2 genotype when compared with *1/*1 (P=0.000038) or *1/*2 (P=0.0085) genotypes. Using the two Asian cohorts, significant association of FCGR2B-232Thr/Thr with SLE was observed only in the presence of CD72-*1/*1 genotype (OR 4.63, 95% CI 1.47-14.6, P=0.009 versus FCGR2B-232Ile/Ile plus CD72-*2/*2). Minigene assays demonstrated that the 13-nucleotide repeat and 4 bp deletion within the same haplotype of intron 8 could regulate alternative splicing. The AS isoform lacks exon 8, and is deduced to contain 49 amino acid changes in the membrane-distal portion of the extracellular domain, where considerable amino acid changes are known in CD72(c) allele associated with murine SLE. These results indicated that the presence of CD72-*2 allele decreases risk for human SLE conferred by FCGR2B-232Thr, possibly by increasing the AS isoform of CD72. | D020022 | Genetic Predisposition to Disease |
Clinically important variants in FCGR2B |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|