Protein:FGFR2 |
Protein Summary |
Gene summary |
| Gene name: FGFR2 | ASpdb.0 ID: 2263 | Gene | Gene symbol | FGFR2 | Gene ID | 2263 |
| Gene name | fibroblast growth factor receptor 2 |
| Synonyms | BBDS|BEK|BFR-1|CD332|CEK3|CFD1|ECT1|JWS|K-SAM|KGFR|TK14|TK25 |
| Cytomap | 10q26.13 |
| Type of gene | protein-coding |
| Description | fibroblast growth factor receptor 2BEK fibroblast growth factor receptorbacteria-expressed kinasekeratinocyte growth factor receptorprotein tyrosine kinase, receptor like 14 |
| Modification date | 20240416 |
| UniProtAcc | P21802 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | FGFR2 | GO:0005007 | fibroblast growth factor receptor activity | 8663044|15629145 |
| Gene | FGFR2 | GO:0005634 | nucleus | 16597614|17471512 |
| Gene | FGFR2 | GO:0005737 | cytoplasm | 16597614|17471512 |
| Gene | FGFR2 | GO:0005886 | plasma membrane | 15629145|16844695 |
| Gene | FGFR2 | GO:0005938 | cell cortex | 17471512 |
| Gene | FGFR2 | GO:0008284 | positive regulation of cell population proliferation | 8663044 |
| Gene | FGFR2 | GO:0008543 | fibroblast growth factor receptor signaling pathway | 8663044|15629145 |
| Gene | FGFR2 | GO:0009986 | cell surface | 16597614 |
| Gene | FGFR2 | GO:0017134 | fibroblast growth factor binding | 8663044 |
| Gene | FGFR2 | GO:0018108 | peptidyl-tyrosine phosphorylation | 15629145|16844695 |
| Gene | FGFR2 | GO:0046777 | protein autophosphorylation | 15629145 |
| Gene | FGFR2 | GO:0062023 | collagen-containing extracellular matrix | 17959718 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P21802-1 | P21802-1_5eg3_A.pdb | 5EG3 | X-ray | 2.61 | A | 466 | 774 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P21802 | FGFR2 | P21802-1 | P21802-14 | 821 | 254 | 250 | 254 | Substitution | ERSPH | GSQGL | 250 | 254 |
| P21802 | FGFR2 | P21802-1 | P21802-14 | 821 | 254 | 255 | 821 | Deletion | none | none | 254 | 254 |
| P21802 | FGFR2 | P21802-1 | P21802-15 | 821 | 705 | 314 | 429 | Deletion | none | none | 313 | 313 |
| P21802 | FGFR2 | P21802-1 | P21802-16 | 821 | 822 | 313 | 313 | Substitution | K | KVTK | 313 | 316 |
| P21802 | FGFR2 | P21802-1 | P21802-16 | 821 | 822 | 428 | 429 | Deletion | none | none | 430 | 430 |
| P21802 | FGFR2 | P21802-1 | P21802-17 | 821 | 769 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 314 | 328 |
| P21802 | FGFR2 | P21802-1 | P21802-17 | 821 | 769 | 334 | 335 | Substitution | FE | EA | 332 | 333 |
| P21802 | FGFR2 | P21802-1 | P21802-17 | 821 | 769 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 339 | 351 |
| P21802 | FGFR2 | P21802-1 | P21802-17 | 821 | 769 | 361 | 361 | Substitution | P | PKQQ | 359 | 362 |
| P21802 | FGFR2 | P21802-1 | P21802-17 | 821 | 769 | 768 | 821 | Substitution | EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | I | 769 | 769 |
| P21802 | FGFR2 | P21802-1 | P21802-18 | 821 | 820 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 314 | 328 |
| P21802 | FGFR2 | P21802-1 | P21802-18 | 821 | 820 | 334 | 335 | Substitution | FE | EA | 332 | 333 |
| P21802 | FGFR2 | P21802-1 | P21802-18 | 821 | 820 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 339 | 351 |
| P21802 | FGFR2 | P21802-1 | P21802-18 | 821 | 820 | 361 | 361 | Substitution | P | PKQQ | 359 | 362 |
| P21802 | FGFR2 | P21802-1 | P21802-18 | 821 | 820 | 428 | 429 | Deletion | none | none | 428 | 428 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 314 | 328 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 334 | 335 | Substitution | FE | EA | 332 | 333 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 339 | 351 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 361 | 361 | Substitution | P | PKQQ | 359 | 362 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 362 | 365 | Substitution | APGR | GRRC | 363 | 366 |
| P21802 | FGFR2 | P21802-1 | P21802-19 | 821 | 366 | 366 | 821 | Deletion | none | none | 366 | 366 |
| P21802 | FGFR2 | P21802-1 | P21802-2 | 821 | 768 | 768 | 821 | Substitution | EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | I | 768 | 768 |
| P21802 | FGFR2 | P21802-1 | P21802-20 | 821 | 704 | 37 | 152 | Substitution | EPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKR | G | 37 | 37 |
| P21802 | FGFR2 | P21802-1 | P21802-20 | 821 | 704 | 429 | 430 | Deletion | none | none | 313 | 313 |
| P21802 | FGFR2 | P21802-1 | P21802-21 | 821 | 707 | 37 | 125 | Deletion | none | none | 36 | 36 |
| P21802 | FGFR2 | P21802-1 | P21802-21 | 821 | 707 | 769 | 821 | Substitution | YLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | EKKVSGAVDCHKPPCNPSHLPCVLAVDQ | 680 | 707 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 37 | 125 | Deletion | none | none | 36 | 36 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 225 | 239 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 334 | 335 | Substitution | FE | EA | 243 | 244 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 250 | 262 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 361 | 361 | Substitution | P | PKQQ | 270 | 273 |
| P21802 | FGFR2 | P21802-1 | P21802-22 | 821 | 680 | 768 | 821 | Substitution | EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | I | 680 | 680 |
| P21802 | FGFR2 | P21802-1 | P21802-23 | 821 | 709 | 250 | 361 | Deletion | none | none | 249 | 249 |
| P21802 | FGFR2 | P21802-1 | P21802-3 | 821 | 822 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 314 | 328 |
| P21802 | FGFR2 | P21802-1 | P21802-3 | 821 | 822 | 334 | 335 | Substitution | FE | EA | 332 | 333 |
| P21802 | FGFR2 | P21802-1 | P21802-3 | 821 | 822 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 339 | 351 |
| P21802 | FGFR2 | P21802-1 | P21802-3 | 821 | 822 | 361 | 361 | Substitution | P | PKQQ | 359 | 362 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 37 | 125 | Deletion | none | none | 36 | 36 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 314 | 330 | Substitution | AAGVNTTDKEIEVLYIR | HSGINSSNAEVLALF | 225 | 239 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 334 | 335 | Substitution | FE | EA | 243 | 244 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 341 | 353 | Substitution | TCLAGNSIGISFH | ICKVSNYIGQANQ | 250 | 262 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 361 | 361 | Substitution | P | PKQQ | 270 | 273 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 428 | 429 | Deletion | none | none | 339 | 339 |
| P21802 | FGFR2 | P21802-1 | P21802-4 | 821 | 682 | 761 | 821 | Substitution | LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | PPNPSLMSIFRK | 671 | 682 |
| P21802 | FGFR2 | P21802-1 | P21802-5 | 821 | 819 | 428 | 429 | Deletion | none | none | 427 | 427 |
| P21802 | FGFR2 | P21802-1 | P21802-6 | 821 | 785 | 428 | 429 | Deletion | none | none | 427 | 427 |
| P21802 | FGFR2 | P21802-1 | P21802-6 | 821 | 785 | 778 | 821 | Substitution | QYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | PYSPCYPDPR | 776 | 785 |
| P21802 | FGFR2 | P21802-1 | P21802-8 | 821 | 766 | 428 | 429 | Deletion | none | none | 427 | 427 |
| P21802 | FGFR2 | P21802-1 | P21802-8 | 821 | 766 | 768 | 821 | Substitution | EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT | I | 766 | 766 |
Multiple sequence alignment of our canonical and alternatively spliced FGFR2 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FGFR2 |
| UniProt-id | ENSG | ENST | ENSP |
| P21802-1 | ENSG00000066468.24 | ENST00000358487.10 | ENSP00000351276.6 |
| P21802-14 | ENSG00000066468.24 | ENST00000359354.6 | ENSP00000352309.2 |
| P21802-15 | ENSG00000066468.24 | ENST00000369060.8 | ENSP00000358056.4 |
| P21802-17 | ENSG00000066468.24 | ENST00000369056.5 | ENSP00000358052.1 |
| P21802-20 | ENSG00000066468.24 | ENST00000356226.8 | ENSP00000348559.4 |
| P21802-20 | ENSG00000066468.24 | ENST00000682550.1 | ENSP00000507633.1 |
| P21802-21 | ENSG00000066468.24 | ENST00000357555.9 | ENSP00000350166.5 |
| P21802-22 | ENSG00000066468.24 | ENST00000360144.7 | ENSP00000353262.3 |
| P21802-23 | ENSG00000066468.24 | ENST00000369061.8 | ENSP00000358057.4 |
| P21802-3 | ENSG00000066468.24 | ENST00000457416.7 | ENSP00000410294.2 |
| P21802-5 | ENSG00000066468.24 | ENST00000346997.6 | ENSP00000263451.5 |
| P21802-5 | ENSG00000066468.24 | ENST00000351936.11 | ENSP00000309878.10 |
| P21802-5 | ENSG00000066468.24 | ENST00000683211.1 | ENSP00000508257.1 |
| UniProt-id | NM ID | NP ID |
| P21802-1 | NM_000141.4 | NP_000132.3 |
| P21802-15 | NM_001144917.1 | NP_001138389.1 |
| P21802-17 | NM_001144913.1 | NP_001138385.1 |
| P21802-20 | NM_001144918.1 | NP_001138390.1 |
| P21802-21 | NM_001144915.1 | NP_001138387.1 |
| P21802-22 | NM_001144919.1 | NP_001138391.1 |
| P21802-23 | NM_001144914.1 | NP_001138386.1 |
| P21802-3 | NM_022970.3 | NP_075259.4 |
| P21802-5 | NM_001320658.1 | NP_001307587.1 |
Amino acid sequences of our canonical and alternatively spliced FGFR2 |
| accession_id | Protein sequence |
| P21802-1 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTR LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLP |
| P21802-14 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP |
| P21802-15 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEF PRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEY ASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDY YKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQ |
| P21802-16 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKVTKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWL TVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITT RLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK MIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAA RNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG HRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCL |
| P21802-17 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPK QQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITT RLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK MIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAA RNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG |
| P21802-18 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPK QQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRL SSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMI GKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARN VLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHR MDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQ |
| P21802-19 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPK |
| P21802-2 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTR LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH |
| P21802-20 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEGAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVE KNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGV FLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFP RDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYA SKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYY KKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQR |
| P21802-21 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRC PAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTV VGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTV LPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITT RLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK MIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAA RNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG |
| P21802-22 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRC PAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTV VGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP KQQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRIT TRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMM KMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLA ARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKE |
| P21802-23 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVAPGREKEITASPDYLEIAIYC IGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDP KWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYV IVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIN NIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHA |
| P21802-3 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPK QQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITT RLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK MIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAA RNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG HRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCL |
| P21802-4 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRC PAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTV VGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLP KQQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTR LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH |
| P21802-5 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLS STADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIG KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNV LVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRM DKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQY |
| P21802-6 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLS STADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIG KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNV LVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRM |
| P21802-8 | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGE YLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVV GGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLS STADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIG KHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNV LVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRM |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| FGFR2 (go to UniProt):P21802 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=250;End=254 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=255;End=821 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=314;End=429 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=313;End=313 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=362;End=365 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=366;End=821 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=37;End=152 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=37;End=125 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=37;End=125 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=250;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=37;End=125 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=314;End=330 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=334;End=335 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=341;End=353 |
| P21802 | Topological domain | 22 | 377 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=361;End=361 |
| P21802 | Transmembrane | 378 | 398 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=255;End=821 |
| P21802 | Transmembrane | 378 | 398 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=314;End=429 |
| P21802 | Transmembrane | 378 | 398 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=366;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=255;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=314;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=768;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=366;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=768;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=429;End=430 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=769;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=768;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=761;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=778;End=821 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=428;End=429 |
| P21802 | Topological domain | 399 | 821 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=768;End=821 |
| P21802 | Domain | 25 | 125 | Note=Ig-like C2-type 1 | Type=Substitution;Start=37;End=152 |
| P21802 | Domain | 25 | 125 | Note=Ig-like C2-type 1 | Type=Deletion;Start=37;End=125 |
| P21802 | Domain | 25 | 125 | Note=Ig-like C2-type 1 | Type=Deletion;Start=37;End=125 |
| P21802 | Domain | 25 | 125 | Note=Ig-like C2-type 1 | Type=Deletion;Start=37;End=125 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Deletion;Start=255;End=821 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Deletion;Start=314;End=429 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=313;End=313 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Deletion;Start=250;End=361 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=314;End=330 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=334;End=335 |
| P21802 | Domain | 256 | 358 | Note=Ig-like C2-type 3 | Type=Substitution;Start=341;End=353 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Deletion;Start=255;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=768;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Deletion;Start=366;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=768;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=769;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=768;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=761;End=821 |
| P21802 | Domain | 481 | 770 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=768;End=821 |
| P21802 | Region | 131 | 151 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=37;End=152 |
Gene Isoform Structures and Expression Levels for FGFR2 |
Gene structures of our canonical and alternative spliced genes of FGFR2* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P21802-1 |
| 3D view using mol* of P21802-14 |
| 3D view using mol* of P21802-15 |
| 3D view using mol* of P21802-16 |
| 3D view using mol* of P21802-17 |
| 3D view using mol* of P21802-18 |
| 3D view using mol* of P21802-19 |
| 3D view using mol* of P21802-2 |
| 3D view using mol* of P21802-20 |
| 3D view using mol* of P21802-21 |
| 3D view using mol* of P21802-22 |
| 3D view using mol* of P21802-23 |
| 3D view using mol* of P21802-3 |
| 3D view using mol* of P21802-4 |
| 3D view using mol* of P21802-5 |
| 3D view using mol* of P21802-6 |
| 3D view using mol* of P21802-8 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P21802-1 | 1.087 | 268 | 1.084 | 904.834 | 0.438 | 0.829 | 1.057 | 1.078 | 1.083 | 0.996 | 0.68 | 204,487,488,490,491,492,493,494,495,515,517,518,51 9,526,527,530,531,534,538,548,564,565,566,567,568, 570,571,625,626,630,631,633,643,644,645,646,647,64 9,657,658,659,660,661,663,664,665,666,670,680 |
| P21802-14 | 0.991 | 173 | 1.001 | 575.211 | 0.635 | 0.684 | 0.932 | 0.308 | 1.071 | 0.287 | 0.653 | 34,35,36,37,38,39,40,41,42,43,44,71,73,74,75,76,78 ,104,105,106,108,115,116,117,118,119,164,166,167,1 68,169,170,173,174,175,176,178,217,226,247,249,250 ,251,252 |
| P21802-15 | 1.047 | 221 | 1.064 | 777.238 | 0.528 | 0.764 | 0.962 | 0.995 | 1.026 | 0.969 | 0.66 | 371,372,374,375,376,377,378,379,399,401,402,403,40 8,410,411,414,415,418,422,432,448,449,450,451,454, 455,509,510,514,515,517,527,528,529,530,531,533,53 7,539,542,543,544,546,547,548,549,550 |
| P21802-16 | 1.029 | 242 | 1.029 | 828.002 | 0.586 | 0.741 | 0.944 | 0.77 | 1.09 | 0.706 | 0.598 | 287,289,314,316,346,348,353,488,489,491,492,493,49 4,495,496,516,518,519,520,521,523,524,525,528,531, 532,535,539,549,565,566,567,568,571,572,625,627,63 1,632,634,644,645,646,647,648,660,662,663,664,665, 666,667 |
| P21802-17 | 1.028 | 551 | 1.062 | 1959.559 | 0.601 | 0.708 | 0.883 | 0.697 | 0.93 | 0.75 | 0.785 | 189,190,191,197,198,199,200,201,203,204,206,207,20 8,209,210,211,212,213,444,445,446,447,448,487,488, 489,490,491,492,493,494,495,496,516,518,519,520,52 1,523,524,525,526,527,528,530,531,532,533,534,535, 538,539,549,565,566,567,568,569,570,571,572,575,57 6,579,580,592,594,626,627,631,632,634,644,645,646, 647,648,650,651,654,655,656,658,659,660,661,662,66 3,664,665,666,667,668,669,670,671,675,676,679,681, 710,714 |
| P21802-18 | 1.041 | 188 | 0.982 | 727.846 | 0.522 | 0.76 | 1.01 | 0.276 | 1.27 | 0.218 | 0.621 | 199,200,201,203,204,205,206,207,208,209,219,220,57 0,572,573,576,577,579,581,582,585,586,587,588,589, 591,592,593,594,629,630,667,668,700,701,702,704,70 5 |
| P21802-19 | 0.928 | 246 | 0.958 | 602.994 | 0.65 | 0.585 | 0.774 | 0.225 | 1.02 | 0.22 | 0.467 | 132,133,135,136,138,139,140,141,142,143,144,145,14 6,147,148,150,151,152,155,157,158,161,176,178,180, 181,182,183,184,185,186,188,189,190,191,197,198,19 9,200,209,211,212,213,214,215,216 |
| P21802-2 | 1.041 | 122 | 0.99 | 321.734 | 0.485 | 0.76 | 0.982 | 0.434 | 1.246 | 0.348 | 0.643 | 625,647,649,653,654,655,656,657,658,659,665,666,67 0,674,675,676,678,679,680,713 |
| P21802-20 | 1.052 | 837 | 1.079 | 2685.69 | 0.487 | 0.751 | 0.963 | 0.804 | 0.956 | 0.841 | 0.736 | 55,56,57,58,84,85,86,88,89,90,91,92,93,104,105,106 ,107,108,135,136,137,138,168,169,232,233,326,327,3 28,329,330,370,373,374,375,376,377,378,398,400,401 ,402,409,410,412,413,414,415,416,417,419,420,421,4 23,424,431,447,448,449,450,451,453,454,456,457,460 ,461,463,469,470,471,472,475,477,503,504,505,508,5 09,511,513,514,516,526,527,528,529,530,532,533,536 ,537,538,539,540,541,542,543,544,545,546,547,548,5 49,550,551,552,558,559,561,563,577,581,583,584,585 ,586,587,588,589,590,591,592,593,596,603,605,606 |
| P21802-21 | 1.043 | 366 | 1.06 | 988.526 | 0.486 | 0.758 | 0.954 | 0.666 | 1.029 | 0.648 | 0.711 | 134,135,161,396,398,399,400,401,402,403,404,405,40 6,426,428,429,430,437,438,441,442,445,449,459,475, 476,477,478,479,481,482,534,536,537,541,542,544,55 4,555,556,557,558,560,561,562,564,565,566,567,568, 569,570,571,572,573,574,575,576,577,581,589,590,59 1,592 |
| P21802-22 | 1.004 | 279 | 1.017 | 803.649 | 0.56 | 0.704 | 0.932 | 0.812 | 1.058 | 0.767 | 0.903 | 353,354,355,356,357,359,400,402,403,404,405,406,40 7,429,430,431,432,434,436,438,439,441,442,443,444, 445,446,448,449,452,453,532,534,537,543,555,556,55 8,559,561,562,564,565,566,567,568,569,570,571,572, 573,574,575,590,592 |
| P21802-23 | 1.017 | 419 | 1.035 | 1250.235 | 0.547 | 0.723 | 0.946 | 0.782 | 1.041 | 0.751 | 0.822 | 329,331,333,335,375,376,378,379,380,381,382,383,40 3,405,406,407,414,415,417,418,419,420,421,422,424, 425,426,427,428,429,436,452,453,454,455,458,459,50 8,509,510,513,514,518,519,521,531,532,533,534,535, 537,538,540,541,542,543,544,545,546,547,548,549,55 0,551,553,554,558,562,563,564,566,567,568,576 |
| P21802-3 | 1.046 | 368 | 1.073 | 1211.133 | 0.548 | 0.742 | 0.954 | 0.836 | 0.957 | 0.873 | 1.066 | 441,442,443,444,445,446,488,489,491,492,493,494,49 5,496,516,518,519,520,527,528,530,531,532,533,534, 535,537,538,539,541,542,549,563,565,566,567,568,57 1,572,621,622,623,626,631,632,634,644,645,646,647, 648,650,651,653,654,655,656,657,658,659,660,661,66 2,664,666,679,681 |
| P21802-4 | 1.033 | 652 | 1.031 | 2635.269 | 0.531 | 0.748 | 0.964 | 0.645 | 1.096 | 0.588 | 0.88 | 82,83,85,111,112,114,115,116,117,118,119,130,131,1 33,134,161,162,163,164,165,193,194,195,196,197,230 ,231,232,255,256,257,351,352,353,354,355,357,397,3 98,400,401,402,403,404,405,425,427,428,429,436,437 ,439,440,441,442,443,444,446,447,448,450,451,458,4 74,475,476,477,480,481,483,487,488,490,496,497,498 ,499,502,504,530,531,532,535,536,540,541,543,553,5 54,555,556,557,558,559,560,563,564,565,566,568,569 ,570,571,572,573,574,575,576,577,578,579,580,585,5 86,588,589,590,604,610,611,612,613,615,616,617,618 ,619,620,623 |
| P21802-5 | 1.012 | 687 | 1.016 | 2280.607 | 0.58 | 0.716 | 0.923 | 0.503 | 1.086 | 0.463 | 0.696 | 172,174,186,187,188,189,190,191,193,197,198,199,20 0,201,202,203,204,205,206,207,208,209,210,211,212, 213,219,220,222,224,225,229,438,439,440,441,442,44 3,444,445,485,486,488,489,490,491,492,493,513,515, 516,517,524,525,527,528,529,530,531,532,534,535,53 8,546,562,563,564,565,568,569,571,572,575,576,578, 584,585,586,587,588,589,590,591,592,618,619,620,62 2,623,624,626,628,629,631,641,642,643,644,645,646, 647,648,650,651,652,653,654,656,657,658,659,660,66 1,662,663,664,665,666,667,668,676,677,678,692,698, 699,700,701,702,703,704,705,706,707,708,718,720,72 1 |
| P21802-6 | 1.054 | 343 | 1.044 | 1179.577 | 0.472 | 0.779 | 1.063 | 0.813 | 1.113 | 0.73 | 0.945 | 347,440,441,442,443,445,488,489,490,491,492,493,51 5,516,517,524,525,527,528,529,530,531,532,534,535, 538,539,618,619,620,623,624,628,642,643,644,645,64 7,648,651,652,653,654,655,656,657,658,659,660,661, 662,663,664,668,674,675,676,677,678 |
| P21802-8 | 1.07 | 204 | 1.014 | 672.966 | 0.541 | 0.803 | 0.972 | 0.469 | 1.249 | 0.375 | 0.529 | 170,171,172,173,223,250,251,253,284,347,348,528,53 1,623,624,644,645,647,651,652,654,655,656,657,658, 659,660,661,662,663,664,665,675,676,677,678 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P21802-1_P21802-1_5eg3_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P21802-1_5eg3_A_P21802-14.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-15.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-16.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-17.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-18.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-19.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-2.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-20.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-21.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-22.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-23.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-3.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-4.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-5.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-6.pdb |
| 3D view using mol* of P21802-1_5eg3_A_P21802-8.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P21802-1_P21802-14.pdb |
| 3D view using mol* of P21802-1_P21802-15.pdb |
| 3D view using mol* of P21802-1_P21802-16.pdb |
| 3D view using mol* of P21802-1_P21802-17.pdb |
| 3D view using mol* of P21802-1_P21802-18.pdb |
| 3D view using mol* of P21802-1_P21802-19.pdb |
| 3D view using mol* of P21802-1_P21802-2.pdb |
| 3D view using mol* of P21802-1_P21802-20.pdb |
| 3D view using mol* of P21802-1_P21802-21.pdb |
| 3D view using mol* of P21802-1_P21802-22.pdb |
| 3D view using mol* of P21802-1_P21802-23.pdb |
| 3D view using mol* of P21802-1_P21802-3.pdb |
| 3D view using mol* of P21802-1_P21802-4.pdb |
| 3D view using mol* of P21802-1_P21802-5.pdb |
| 3D view using mol* of P21802-1_P21802-6.pdb |
| 3D view using mol* of P21802-1_P21802-8.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to FGFR2 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P21802 | FGFR2 | DB12010 | Fostamatinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB00039 | Palifermin | approved | agonist, binder |
| P21802 | FGFR2 | DB15685 | Selpercatinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB11886 | Infigratinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB17587 | KIN-3248 | investigational | inhibitor |
| P21802 | FGFR2 | DB08896 | Regorafenib | approved | inhibitor |
| P21802 | FGFR2 | DB01109 | Heparin | approved, investigational | |
| P21802 | FGFR2 | DB12147 | Erdafitinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB01901 | Sucrosofate | experimental | ligand |
| P21802 | FGFR2 | DB09078 | Lenvatinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB02491 | 4-[4-(1-Amino-1-Methylethyl)Phenyl]-5-Chloro-N-[4-(2-Morpholin-4-Ylethyl)Phenyl]Pyrimidin-2-Amine | experimental | |
| P21802 | FGFR2 | DB15822 | Pralsetinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB15102 | Pemigatinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB09079 | Nintedanib | approved | inhibitor |
| P21802 | FGFR2 | DB02058 | 3-[4-(1-formylpiperazin-4-yl)-benzylidenyl]-2-indolinone | experimental | |
| P21802 | FGFR2 | DB08901 | Ponatinib | approved, investigational | inhibitor |
| P21802 | FGFR2 | DB10772 | Foreskin keratinocyte (neonatal) | approved | agonist |
| P21802 | FGFR2 | DB10770 | Foreskin fibroblast (neonatal) | approved | agonist |
| P21802 | FGFR2 | DB15149 | Futibatinib | approved, investigational | inhibitor |
Related Diseases to FGFR2 |
Previous studies relating to the alternative splicing of FGFR2 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| FGFR2 | 1648704 | Multiple mRNAs code for proteins related to the BEK fibroblast growth factor receptor. | The BEK transmembrane protein tyrosine kinase is a receptor for both acidic and basic fibroblast growth factors. We identify several different transcripts which code for BEK-related proteins. These proteins differ from BEK in regions expected to control receptor activity. Thus, some of the proteins have altered extracellular, ligand-binding domains, and others an altered carboxy-terminal tail. Still other forms of BEK differ only in their juxtamembrane domains. Sequencing of parts of the BEK gene shows that alternative splicing of the premessenger can account for at least some of this diversity. In particular, an apparently tissue specific, mutually exclusive splicing of two internal exons permits both the previously described K-SAM mRNA and the BEK mRNA to be derived from the same premessenger. | D000230 | Adenocarcinoma |
| FGFR2 | 1648704 | Multiple mRNAs code for proteins related to the BEK fibroblast growth factor receptor. | The BEK transmembrane protein tyrosine kinase is a receptor for both acidic and basic fibroblast growth factors. We identify several different transcripts which code for BEK-related proteins. These proteins differ from BEK in regions expected to control receptor activity. Thus, some of the proteins have altered extracellular, ligand-binding domains, and others an altered carboxy-terminal tail. Still other forms of BEK differ only in their juxtamembrane domains. Sequencing of parts of the BEK gene shows that alternative splicing of the premessenger can account for at least some of this diversity. In particular, an apparently tissue specific, mutually exclusive splicing of two internal exons permits both the previously described K-SAM mRNA and the BEK mRNA to be derived from the same premessenger. | D001943 | Breast Neoplasms |
| FGFR2 | 1648704 | Multiple mRNAs code for proteins related to the BEK fibroblast growth factor receptor. | The BEK transmembrane protein tyrosine kinase is a receptor for both acidic and basic fibroblast growth factors. We identify several different transcripts which code for BEK-related proteins. These proteins differ from BEK in regions expected to control receptor activity. Thus, some of the proteins have altered extracellular, ligand-binding domains, and others an altered carboxy-terminal tail. Still other forms of BEK differ only in their juxtamembrane domains. Sequencing of parts of the BEK gene shows that alternative splicing of the premessenger can account for at least some of this diversity. In particular, an apparently tissue specific, mutually exclusive splicing of two internal exons permits both the previously described K-SAM mRNA and the BEK mRNA to be derived from the same premessenger. | D002583 | Uterine Cervical Neoplasms |
| FGFR2 | 1652059 | The human fibroblast growth factor receptor genes: a common structural arrangement underlies the mechanisms for generating receptor forms that differ in their third immunoglobulin domain. | To determine the mechanisms by which multiple forms of fibroblast growth factor (FGF) receptors are generated, we have mapped the arrangement of exons and introns in the human FGF receptor 1 (FGFR 1) gene (flg). We found three alternative exons encoding a portion of the third immunoglobulin (Ig)-like domain of the receptor. One of these alternatives encodes a sequence that is part of a secreted form of FGFR 1. The other two encode sequences that are likely part of transmembrane forms of FGFR 1. One of these forms has not been previously reported in published cDNAs. Also, we have determined the structural organization of a portion of the human FGFR 2 gene (bek) and found a similar arrangement of alternative exons for the third Ig-like domain. The arrangement of these genes suggests that there are conserved mechanisms governing the expression of secreted FGF receptors as well as the expression of at least two distinct membrane-spanning forms of the FGF receptors. The diverse forms appear to be generated by alternative splicing of mRNA and selective use of polyadenylation signals. | D001254 | Astrocytoma |
| FGFR2 | 1652059 | The human fibroblast growth factor receptor genes: a common structural arrangement underlies the mechanisms for generating receptor forms that differ in their third immunoglobulin domain. | To determine the mechanisms by which multiple forms of fibroblast growth factor (FGF) receptors are generated, we have mapped the arrangement of exons and introns in the human FGF receptor 1 (FGFR 1) gene (flg). We found three alternative exons encoding a portion of the third immunoglobulin (Ig)-like domain of the receptor. One of these alternatives encodes a sequence that is part of a secreted form of FGFR 1. The other two encode sequences that are likely part of transmembrane forms of FGFR 1. One of these forms has not been previously reported in published cDNAs. Also, we have determined the structural organization of a portion of the human FGFR 2 gene (bek) and found a similar arrangement of alternative exons for the third Ig-like domain. The arrangement of these genes suggests that there are conserved mechanisms governing the expression of secreted FGF receptors as well as the expression of at least two distinct membrane-spanning forms of the FGF receptors. The diverse forms appear to be generated by alternative splicing of mRNA and selective use of polyadenylation signals. | D009447 | Neuroblastoma |
| FGFR2 | 1652059 | The human fibroblast growth factor receptor genes: a common structural arrangement underlies the mechanisms for generating receptor forms that differ in their third immunoglobulin domain. | To determine the mechanisms by which multiple forms of fibroblast growth factor (FGF) receptors are generated, we have mapped the arrangement of exons and introns in the human FGF receptor 1 (FGFR 1) gene (flg). We found three alternative exons encoding a portion of the third immunoglobulin (Ig)-like domain of the receptor. One of these alternatives encodes a sequence that is part of a secreted form of FGFR 1. The other two encode sequences that are likely part of transmembrane forms of FGFR 1. One of these forms has not been previously reported in published cDNAs. Also, we have determined the structural organization of a portion of the human FGFR 2 gene (bek) and found a similar arrangement of alternative exons for the third Ig-like domain. The arrangement of these genes suggests that there are conserved mechanisms governing the expression of secreted FGF receptors as well as the expression of at least two distinct membrane-spanning forms of the FGF receptors. The diverse forms appear to be generated by alternative splicing of mRNA and selective use of polyadenylation signals. | D012509 | Sarcoma |
| FGFR2 | 18593464 | Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. | Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis. | D001172 | Arthritis, Rheumatoid |
| FGFR2 | 18593464 | Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. | Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis. | D004195 | Disease Models, Animal |
| FGFR2 | 22345151 | FGFR2 isoforms support epithelial-stromal interactions in thyroid cancer progression. | Alternate splicing yields two distinct isoforms of the fibroblast growth factor (FGF) receptor FGFR2-IIIb and FGFR2-IIIc varying their extracellular structure in human thyroid cancer, in which FGFR expression is commonly dysregulated. In this study, we characterized the function of these variants in modulating thyroid cancer behavior. Enforced expression of either FGFR2-IIIb or FGFR2-IIIc in thyroid epithelial cancer cells reduced expression of fibronectin, MAGE-A3 and MMP9, while increasing p21 and enhancing Rb dephosphorylation. Consistent with these tumor-suppressive properties, FGFR2-IIIb and FGFR2-IIIc each diminished invasive behavior in vitro and reduced tumor growth and metastasis in vivo. Notably, these effects contrasted with those produced by expression of these FGFR isoforms in fibroblasts, in which they both stimulated cell growth. Moreover, in xenograft tumors generated by coimplantation of epithelial and fibroblast cells expressing that same isoform, there was no significant effect on tumor progression. Conversely, FGFR2-IIIb expression in epithelial cells yielded higher FGF4/FGF7 expression that, in the presence of FGFR2-IIIc-expressing fibroblasts, enhanced tumor progression. Together, our findings highlight the importance of cellular context in assigning growth properties to growth factor receptor isoforms. More specifically, they show how alternative splicing of FGFR2 yields heteroisoforms critical to the growth-promoting actions of FGFs that exert distinct epithelial-stromal effects in thyroid cancer. | D018450 | Disease Progression |
| FGFR2 | 22345151 | FGFR2 isoforms support epithelial-stromal interactions in thyroid cancer progression. | Alternate splicing yields two distinct isoforms of the fibroblast growth factor (FGF) receptor FGFR2-IIIb and FGFR2-IIIc varying their extracellular structure in human thyroid cancer, in which FGFR expression is commonly dysregulated. In this study, we characterized the function of these variants in modulating thyroid cancer behavior. Enforced expression of either FGFR2-IIIb or FGFR2-IIIc in thyroid epithelial cancer cells reduced expression of fibronectin, MAGE-A3 and MMP9, while increasing p21 and enhancing Rb dephosphorylation. Consistent with these tumor-suppressive properties, FGFR2-IIIb and FGFR2-IIIc each diminished invasive behavior in vitro and reduced tumor growth and metastasis in vivo. Notably, these effects contrasted with those produced by expression of these FGFR isoforms in fibroblasts, in which they both stimulated cell growth. Moreover, in xenograft tumors generated by coimplantation of epithelial and fibroblast cells expressing that same isoform, there was no significant effect on tumor progression. Conversely, FGFR2-IIIb expression in epithelial cells yielded higher FGF4/FGF7 expression that, in the presence of FGFR2-IIIc-expressing fibroblasts, enhanced tumor progression. Together, our findings highlight the importance of cellular context in assigning growth properties to growth factor receptor isoforms. More specifically, they show how alternative splicing of FGFR2 yields heteroisoforms critical to the growth-promoting actions of FGFs that exert distinct epithelial-stromal effects in thyroid cancer. | D013964 | Thyroid Neoplasms |
Clinically important variants in FGFR2 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|