Protein:FOXM1 |
Protein Summary |
 Gene summary |
| Gene name: FOXM1 | ASpdb.0 ID: 2305 | Gene | Gene symbol | FOXM1 | Gene ID | 2305 |
| Gene name | forkhead box M1 |
| Synonyms | FKHL16|FOXM1A|FOXM1B|FOXM1C|HFH-11|HFH11|HNF-3|INS-1|MPHOSPH2|MPP-2|MPP2|PIG29|TRIDENT |
| Cytomap | 12p13.33 |
| Type of gene | protein-coding |
| Description | forkhead box protein M1Forkhead, drosophila, homolog-like 16HNF-3/fork-head homolog 11M-phase phosphoprotein 2MPM-2 reactive phosphoprotein 2forkhead box M1-Dforkhead-related protein FKHL16hepatocyte nuclear factor 3 forkhead homolog 11transcripti |
| Modification date | 20240416 |
| UniProtAcc | Q08050 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | FOXM1 | GO:0000086 | G2/M transition of mitotic cell cycle | 19160488 |
| Gene | FOXM1 | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding | 21860419 |
| Gene | FOXM1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 19160488 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q08050-1 | Q08050-1_3g73_B.pdb | 3G73 | X-ray | 2.21 | B | 234 | 328 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q08050 | FOXM1 | Q08050-1 | Q08050-2 | 763 | 748 | 326 | 340 | Deletion | none | none | 325 | 325 |
| Q08050 | FOXM1 | Q08050-1 | Q08050-3 | 763 | 801 | 423 | 423 | Substitution | V | VFGEQVVFGYMSKFFSGDLRDFGTPITSLFNFIFLCLSV | 423 | 461 |
| Multiple sequence alignment of our canonical and alternatively spliced FOXM1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FOXM1 |
| UniProt-id | ENSG | ENST | ENSP |
| Q08050-1 | ENSG00000111206.13 | ENST00000359843.8 | ENSP00000352901.4 |
| Q08050-2 | ENSG00000111206.13 | ENST00000361953.7 | ENSP00000354492.3 |
| Q08050-3 | ENSG00000111206.13 | ENST00000342628.6 | ENSP00000342307.2 |
| UniProt-id | NM ID | NP ID |
| Q08050-1 | NM_021953.3 | NP_068772.2 |
| Q08050-2 | NM_202003.2 | NP_973732.1 |
| Q08050-3 | NM_202002.2 | NP_973731.1 |
| Amino acid sequences of our canonical and alternatively spliced FOXM1 |
| accession_id | Protein sequence |
| Q08050-1 | MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITA LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHF PYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGF SPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPA KVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE |
| Q08050-2 | MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITA LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHF PYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVS SYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQ PGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCV DEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQG ASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKIL |
| Q08050-3 | MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITA LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHF PYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVFGEQVVFGYMSKFFSGDLRDFGTPITS LFNFIFLCLSVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSW EDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQ EVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| FOXM1 (go to UniProt):Q08050 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q08050 | DNA binding | 235 | 327 | Note=Fork-head;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00089 | Type=Deletion;Start=326;End=340 |
| Q08050 | Region | 329 | 351 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=326;End=340 |
Gene Isoform Structures and Expression Levels for FOXM1 |
| Gene structures of our canonical and alternative spliced genes of FOXM1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q08050-1 |
| 3D view using mol* of Q08050-2 |
| 3D view using mol* of Q08050-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q08050-1 |
 |
| pLDDT distribution across the protein length of Q08050-2 |
 |
| pLDDT distribution across the protein length of Q08050-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q08050-1 |
 |
| Ramachandran plot of Q08050-2 |
 |
| Ramachandran plot of Q08050-3 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q08050-1 | 1.04 | 137 | 1.113 | 446.243 | 0.523 | 0.651 | 0.863 | 1.187 | 0.667 | 1.778 | 0.921 | 87,88,91,92,95,96,98,99,100,102,103,104,105,106,10 8,728,730,731,733,734,735,736,737,738 |
| Q08050-2 | 0.666 | 35 | 0.61 | 146.118 | 0.685 | 0.637 | 0.845 | 0.392 | 1.006 | 0.39 | 2.023 | 232,233,235,237,238,239,269,270,271,272,324,327,32 8 |
| Q08050-3 | 1.047 | 238 | 1.106 | 745.682 | 0.457 | 0.683 | 0.915 | 1.117 | 0.749 | 1.493 | 1.291 | 63,65,67,68,69,70,75,77,78,84,88,91,92,95,96,99,10 0,104,105,106,107,108,109,110,112,769,771,772,773, 774,775,776,777,778,793,796,797,800 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q08050-1_Q08050-1_3g73_B.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q08050-1_3g73_B_Q08050-2.pdb |
| 3D view using mol* of Q08050-1_3g73_B_Q08050-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q08050-1_Q08050-2.pdb |
| 3D view using mol* of Q08050-1_Q08050-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q08050-1_vs_Q08050-2.png |
 < |
| ./stats/secondary_structure/figure/Q08050-1_vs_Q08050-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q08050-1_vs_Q08050-2.png |
 < |
| ./stats/relative_asa/Q08050-1_vs_Q08050-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to FOXM1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to FOXM1 |
| Previous studies relating to the alternative splicing of FOXM1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| FOXM1 | 9242644 | Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain. | We have cloned a novel winged helix factor, WIN, from the rat insulinoma cell line, INS-1. Northern blot analysis demonstrated that WIN is highly expressed in a variety of insulinoma cell lines and rat embryonic pancreas and liver. In adults, WIN expression was detected in thymus, testis, lung, and several intestinal regions. We determined the DNA sequences bound in vitro by baculovirus-expressed WIN protein in a polymerase chain reaction-based selection procedure. WIN was found to bind with high affinity to the selected sequence 5'-AGATTGAGTA-3', which is similar to the recently identified HNF-6 binding sequence 5'-DHWATTGAYTWWD-3' (where W = A or T, Y = T or C, H is not G, and D is not C). We have isolated human WIN cDNAs by library screening and 5'-rapid amplification of cDNA ends. Sequence analysis indicates that the carboxyl terminus of human WIN has been previously isolated as a putative phosphorylation substrate, MPM2-reactive phosphoprotein 2 (MPP2); WIN may be regulated by phosphorylation. Alignment of the rat and human WIN cDNAs and their comparison with mouse genomic sequence revealed that the WIN DNA binding domain is encoded by four exons, two of which (exons 4 and 6) are alternatively spliced to generate at least three classes of mRNA transcripts. These transcripts were shown by RNase protection assay to be differentially expressed in different tissues. Alternative splicing within the winged helix DNA binding domain might result in modulation of DNA binding specificity. | D007340 | Insulinoma |
Clinically important variants in FOXM1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |