ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:FLT1

Protein Summary

Gene summary

Gene name: FLT1
ASpdb.0 ID: 2321
	Gene
Gene symbol	FLT1
Gene ID	2321
Gene name	fms related receptor tyrosine kinase 1
Synonyms	FLT\|FLT-1\|VEGFR-1\|VEGFR1
Cytomap	13q12.3
Type of gene	protein-coding
Description	vascular endothelial growth factor receptor 1fms related tyrosine kinase 1fms-like tyrosine kinase 1fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)tyrosine-protein kinase FRTtyrosine-protein ki
Modification date	20240411
UniProtAcc	P17948

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	FLT1	GO:0002548	monocyte chemotaxis	8605350\|18079407
Gene	FLT1	GO:0005021	vascular endothelial growth factor receptor activity	1312256\|8605350\|9299537\|15952180
Gene	FLT1	GO:0005886	plasma membrane	11513746
Gene	FLT1	GO:0015629	actin cytoskeleton	-
Gene	FLT1	GO:0018108	peptidyl-tyrosine phosphorylation	9299537\|11513746
Gene	FLT1	GO:0030335	positive regulation of cell migration	8605350
Gene	FLT1	GO:0035924	cellular response to vascular endothelial growth factor stimulus	8605350
Gene	FLT1	GO:0036323	vascular endothelial growth factor receptor-1 signaling pathway	15952180
Gene	FLT1	GO:0036332	placental growth factor receptor activity	12796773
Gene	FLT1	GO:0043235	receptor complex	23382219
Gene	FLT1	GO:0043406	positive regulation of MAP kinase activity	9299537
Gene	FLT1	GO:0043410	positive regulation of MAPK cascade	9299537
Gene	FLT1	GO:0046777	protein autophosphorylation	9299537\|11513746
Gene	FLT1	GO:0048010	vascular endothelial growth factor receptor signaling pathway	1312256\|9299537

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
P17948-1	P17948-1_5t89_Y.pdb	5T89	X-ray	4.0	Y	31	654

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
P17948	FLT1	P17948-1	P17948-2	1338	687	657	687	Substitution	DQEAPYLLRNLSDHTVAISSSTTLDCHANGV	GEHCNKKAVFSRISKFKSTRNDCTTQSNVKH	657	687
P17948	FLT1	P17948-1	P17948-2	1338	687	688	1338	Deletion	none	none	687	687
P17948	FLT1	P17948-1	P17948-3	1338	733	706	733	Substitution	GIILGPGSSTLFIERVTEEDEGVYHCKA	ELYTSTSPSSSSSSPLSSSSSSSSSSSS	706	733
P17948	FLT1	P17948-1	P17948-3	1338	733	734	1338	Deletion	none	none	733	733
P17948	FLT1	P17948-1	P17948-4	1338	541	518	541	Substitution	MASTLVVADSRISGIYICIASNKV	LPPANSSFMLPPTSFSSNYFHFLP	518	541
P17948	FLT1	P17948-1	P17948-4	1338	541	542	1338	Deletion	none	none	541	541
P17948	FLT1	P17948-1	P17948-5	1338	556	1	782	Deletion	none	none	0	0
P17948	FLT1	P17948-1	P17948-6	1338	463	1	875	Deletion	none	none	0	0
P17948	FLT1	P17948-1	P17948-7	1338	343	1	995	Deletion	none	none	0	0
P17948	FLT1	P17948-1	P17948-8	1338	361	1	7	Substitution	MVSYWDT	MNSDLLV	1	7
P17948	FLT1	P17948-1	P17948-8	1338	361	8	984	Deletion	none	none	7	7

Multiple sequence alignment of our canonical and alternatively spliced FLT1

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FLT1

UniProt-id	ENSG	ENST	ENSP
P17948-1	ENSG00000102755.13	ENST00000282397.9	ENSP00000282397.4
P17948-2	ENSG00000102755.13	ENST00000615840.5	ENSP00000484039.1
P17948-3	ENSG00000102755.13	ENST00000541932.5	ENSP00000437631.1
P17948-4	ENSG00000102755.13	ENST00000539099.2	ENSP00000442630.1

UniProt-id	NM ID	NP ID
P17948-1	NM_002019.4	NP_002010.2
P17948-2	NM_001159920.1	NP_001153392.1
P17948-3	NM_001160030.1	NP_001153502.1
P17948-4	NM_001160031.1	NP_001153503.1

Amino acid sequences of our canonical and alternatively spliced FLT1

accession_id	Protein sequence
P17948-1	MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCS TLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPD EKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQD SGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQC ERLPYDASKWEFARERLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGFY KEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYI PINAILTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
P17948-2	MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCS TLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPD EKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQD
P17948-3	MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCS TLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPD EKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQD SGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPELYTSTSPSSSSSSP
P17948-4	MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCS TLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPD EKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKLPPANSSFMLPPTSFSSNYFHFL
P17948-5	MKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKMLKEGATASEY KALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTS SESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPD YVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPK ERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELL PNATSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCS
P17948-6	MTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSES FASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVR KGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERP RFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNA TSMFDDYQGDSSTLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPP
P17948-7	MEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSY GVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAI LTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTWTDSKP
P17948-8	MNSDLLVDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMA PESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDL LQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSS TLLASPMLKRFTWTDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSVVLYSTPP

Protein Functional Features

Main function of this protein. (from UniProt)

FLT1 (go to UniProt):P17948

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=657;End=687
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=688;End=1338
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=706;End=733
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=734;End=1338
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=518;End=541
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=542;End=1338
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=782
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=875
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=995
P17948	Topological domain	27	758	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=8;End=984
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=688;End=1338
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=734;End=1338
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=542;End=1338
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=782
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=875
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=995
P17948	Transmembrane	759	780	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=8;End=984
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=688;End=1338
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=734;End=1338
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=542;End=1338
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=782
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=875
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=995
P17948	Topological domain	781	1338	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=8;End=984
P17948	Domain	32	123	Note=Ig-like C2-type 1	Type=Deletion;Start=1;End=782
P17948	Domain	32	123	Note=Ig-like C2-type 1	Type=Deletion;Start=1;End=875
P17948	Domain	32	123	Note=Ig-like C2-type 1	Type=Deletion;Start=1;End=995
P17948	Domain	32	123	Note=Ig-like C2-type 1	Type=Deletion;Start=8;End=984
P17948	Domain	151	214	Note=Ig-like C2-type 2	Type=Deletion;Start=1;End=782
P17948	Domain	151	214	Note=Ig-like C2-type 2	Type=Deletion;Start=1;End=875
P17948	Domain	151	214	Note=Ig-like C2-type 2	Type=Deletion;Start=1;End=995
P17948	Domain	151	214	Note=Ig-like C2-type 2	Type=Deletion;Start=8;End=984
P17948	Domain	230	327	Note=Ig-like C2-type 3	Type=Deletion;Start=1;End=782
P17948	Domain	230	327	Note=Ig-like C2-type 3	Type=Deletion;Start=1;End=875
P17948	Domain	230	327	Note=Ig-like C2-type 3	Type=Deletion;Start=1;End=995
P17948	Domain	230	327	Note=Ig-like C2-type 3	Type=Deletion;Start=8;End=984
P17948	Domain	335	421	Note=Ig-like C2-type 4	Type=Deletion;Start=1;End=782
P17948	Domain	335	421	Note=Ig-like C2-type 4	Type=Deletion;Start=1;End=875
P17948	Domain	335	421	Note=Ig-like C2-type 4	Type=Deletion;Start=1;End=995
P17948	Domain	335	421	Note=Ig-like C2-type 4	Type=Deletion;Start=8;End=984
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Substitution;Start=518;End=541
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Deletion;Start=542;End=1338
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Deletion;Start=1;End=782
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Deletion;Start=1;End=875
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Deletion;Start=1;End=995
P17948	Domain	428	553	Note=Ig-like C2-type 5	Type=Deletion;Start=8;End=984
P17948	Domain	556	654	Note=Ig-like C2-type 6	Type=Deletion;Start=542;End=1338
P17948	Domain	556	654	Note=Ig-like C2-type 6	Type=Deletion;Start=1;End=782
P17948	Domain	556	654	Note=Ig-like C2-type 6	Type=Deletion;Start=1;End=875
P17948	Domain	556	654	Note=Ig-like C2-type 6	Type=Deletion;Start=1;End=995
P17948	Domain	556	654	Note=Ig-like C2-type 6	Type=Deletion;Start=8;End=984
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Substitution;Start=657;End=687
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=688;End=1338
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Substitution;Start=706;End=733
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=734;End=1338
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=542;End=1338
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=1;End=782
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=1;End=875
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=1;End=995
P17948	Domain	661	747	Note=Ig-like C2-type 7	Type=Deletion;Start=8;End=984
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=688;End=1338
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=734;End=1338
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=542;End=1338
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=1;End=875
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=1;End=995
P17948	Domain	827	1158	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=8;End=984
P17948	Region	940	982	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=688;End=1338
P17948	Region	940	982	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=734;End=1338
P17948	Region	940	982	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=542;End=1338
P17948	Region	940	982	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=1;End=995
P17948	Region	940	982	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=8;End=984
P17948	Compositional bias	956	974	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=688;End=1338
P17948	Compositional bias	956	974	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=734;End=1338
P17948	Compositional bias	956	974	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=542;End=1338
P17948	Compositional bias	956	974	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=1;End=995
P17948	Compositional bias	956	974	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=8;End=984

Gene Isoform Structures and Expression Levels for FLT1

Gene structures of our canonical and alternative spliced genes of FLT1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of P17948-1

3D view using mol* of P17948-2

3D view using mol* of P17948-3

3D view using mol* of P17948-4

3D view using mol* of P17948-5

3D view using mol* of P17948-6

3D view using mol* of P17948-7

3D view using mol* of P17948-8

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of P17948-1

pLDDT distribution across the protein length of P17948-2

pLDDT distribution across the protein length of P17948-3

pLDDT distribution across the protein length of P17948-4

pLDDT distribution across the protein length of P17948-5

pLDDT distribution across the protein length of P17948-6

pLDDT distribution across the protein length of P17948-7

pLDDT distribution across the protein length of P17948-8

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of P17948-1

Ramachandran plot of P17948-4

Ramachandran plot of P17948-5

Ramachandran plot of P17948-6

Ramachandran plot of P17948-8

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
P17948-1	1.035	383	1.061	1071.875	0.547	0.73	0.928	0.809	0.971	0.833	0.945	798,806,807,810,829,833,834,835,836,837,838,839,84 0,841,842,859,861,863,864,865,870,871,873,874,877, 878,881,882,892,904,907,909,910,911,912,915,916,91 8,919,922,1018,1019,1020,1021,1022,1024,1025,1026, 1027,1029,1039,1040,1041,1042,1043,1044,1045,1046, 1047,1048,1049,1050,1052,1053,1056,1057,1058,1059, 1061,1062,1065,1066,1070,1071,1074,1076,1091,1096, 1097,1098,1099
P17948-2	0.987	197	1.01	600.593	0.605	0.674	0.85	0.373	1.026	0.364	0.878	432,435,436,437,438,440,441,442,444,452,453,469,47 0,471,472,473,475,478,479,480,481,482,483,484,485, 487,532,546,548,549,551,581,582,584,585,641,642
P17948-3	1.002	108	1.011	314.188	0.647	0.701	0.947	0.447	1.074	0.417	1.013	469,470,471,472,473,474,475,479,480,481,482,483,48 4,487,532,551,581,582,584,585,586,617,641,642
P17948-4	1.026	181	1.066	493.577	0.552	0.693	0.912	0.8	0.889	0.901	0.741	441,442,443,444,446,450,452,466,471,472,473,475,47 6,477,478,480,499,500,525,527,528,530,531,532,533, 534,535,536,537,539
P17948-5	1.076	246	1.108	579.327	0.474	0.772	0.974	1.12	0.906	1.237	0.948	132,138,150,153,154,207,210,211,212,213,215,216,21 9,220,222,223,248,249,250,251,252,253,376,377,380, 387,390,533,534,536,537,538,539,540,541,542,543,54 5
P17948-6	1.075	112	1.137	304.927	0.479	0.717	0.975	1.423	0.715	1.989	1.179	252,253,255,256,257,259,260,278,281,282,340,342,34 3,344,345,347
P17948-7	0.945	154	0.974	388.276	0.654	0.61	0.809	0.374	1.02	0.367	0.626	53,54,55,56,57,58,59,60,61,63,64,65,68,69,70,103,1 05,106,107,108,109,110,111,112,115,259,260,261,262 ,263,264,265,266,267,268
P17948-8	1.017	224	1.072	614.313	0.606	0.653	0.824	0.905	0.796	1.137	1.414	12,13,14,15,16,17,18,19,20,21,22,25,29,47,48,49,51 ,52,53,57,59,75,88,111,114,115,118,119,120,121,122 ,147,184,188,190,279,280,281,282,283

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of P17948-1_P17948-1_5t89_Y.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of P17948-1_5t89_Y_P17948-2.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-3.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-4.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-5.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-6.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-7.pdb

3D view using mol* of P17948-1_5t89_Y_P17948-8.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of P17948-1_P17948-2.pdb

3D view using mol* of P17948-1_P17948-3.pdb

3D view using mol* of P17948-1_P17948-4.pdb

3D view using mol* of P17948-1_P17948-5.pdb

3D view using mol* of P17948-1_P17948-6.pdb

3D view using mol* of P17948-1_P17948-7.pdb

3D view using mol* of P17948-1_P17948-8.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/P17948-1_vs_P17948-2.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-3.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-4.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-5.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-6.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-7.png

./stats/secondary_structure/figure/P17948-1_vs_P17948-8.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/P17948-1_vs_P17948-2.png

./stats/relative_asa/P17948-1_vs_P17948-3.png

./stats/relative_asa/P17948-1_vs_P17948-4.png

./stats/relative_asa/P17948-1_vs_P17948-5.png

./stats/relative_asa/P17948-1_vs_P17948-6.png

./stats/relative_asa/P17948-1_vs_P17948-7.png

./stats/relative_asa/P17948-1_vs_P17948-8.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id

Subsection

Start

End

Funcitonal feature

Splicing information

Interactors from STRING.

Gene name

Interactors

Related Drugs to FLT1

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession	Gene name	DrugBank ID	Drug name	Drug group	Actions
P17948	FLT1	DB01268	Sunitinib	approved, investigational	inhibitor
P17948	FLT1	DB05075	TG-100801	investigational
P17948	FLT1	DB06589	Pazopanib	approved	inhibitor
P17948	FLT1	DB04879	Vatalanib	investigational
P17948	FLT1	DB09078	Lenvatinib	approved, investigational	inhibitor
P17948	FLT1	DB15685	Selpercatinib	approved, investigational	inhibitor
P17948	FLT1	DB10770	Foreskin fibroblast (neonatal)	approved	agonist
P17948	FLT1	DB00398	Sorafenib	approved, investigational	inhibitor
P17948	FLT1	DB05913	OSI-930	investigational
P17948	FLT1	DB05932	Denibulin	investigational
P17948	FLT1	DB09221	Polaprezinc	experimental	agonist
P17948	FLT1	DB12010	Fostamatinib	approved, investigational	inhibitor
P17948	FLT1	DB06080	Linifanib	investigational
P17948	FLT1	DB11679	Fruquintinib	approved, investigational	inhibitor
P17948	FLT1	DB06101	IMC-1C11	investigational
P17948	FLT1	DB11800	Tivozanib	approved, investigational	inhibitor
P17948	FLT1	DB07288	N-(4-chlorophenyl)-2-[(pyridin-4-ylmethyl)amino]benzamide	experimental
P17948	FLT1	DB08896	Regorafenib	approved	inhibitor
P17948	FLT1	DB06626	Axitinib	approved, investigational	inhibitor
P17948	FLT1	DB09079	Nintedanib	approved	inhibitor

Related Diseases to FLT1

Previous studies relating to the alternative splicing of FLT1 and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
FLT1	14674128	[Correlation between transcriptional activity of vascular endothelial growth factor (VEFG) and transcriptional activity of its receptors (FLT-1 and FLK-1) in low-grade squamous intraepithelial lesions (LSIL) of uterine cervix].	"In this report we focus on angiogenesis, as one component of a complex molecular relations in the process of neovascularisation in the low-grade intraepithelial changes (LSIL). Increasing number of publications indicates that the interrelation between isoforms of VEGF (VEGF121, VEGF145, VEGF165, VEGF183, VEGF189, VEGF206) but not total VEGF is responsible for angiogenesis, both in physiological and pathological processes. The molecular co-operation of the said isoforms and their receptors results in morphological presentation of ""de novo"" created vascular network that dynamically involves the entire connective tissue stroma of the uterine cervix."	D002294	Carcinoma, Squamous Cell
FLT1	14674128	[Correlation between transcriptional activity of vascular endothelial growth factor (VEFG) and transcriptional activity of its receptors (FLT-1 and FLK-1) in low-grade squamous intraepithelial lesions (LSIL) of uterine cervix].	"In this report we focus on angiogenesis, as one component of a complex molecular relations in the process of neovascularisation in the low-grade intraepithelial changes (LSIL). Increasing number of publications indicates that the interrelation between isoforms of VEGF (VEGF121, VEGF145, VEGF165, VEGF183, VEGF189, VEGF206) but not total VEGF is responsible for angiogenesis, both in physiological and pathological processes. The molecular co-operation of the said isoforms and their receptors results in morphological presentation of ""de novo"" created vascular network that dynamically involves the entire connective tissue stroma of the uterine cervix."	D009389	Neovascularization, Pathologic
FLT1	14674128	[Correlation between transcriptional activity of vascular endothelial growth factor (VEFG) and transcriptional activity of its receptors (FLT-1 and FLK-1) in low-grade squamous intraepithelial lesions (LSIL) of uterine cervix].	"In this report we focus on angiogenesis, as one component of a complex molecular relations in the process of neovascularisation in the low-grade intraepithelial changes (LSIL). Increasing number of publications indicates that the interrelation between isoforms of VEGF (VEGF121, VEGF145, VEGF165, VEGF183, VEGF189, VEGF206) but not total VEGF is responsible for angiogenesis, both in physiological and pathological processes. The molecular co-operation of the said isoforms and their receptors results in morphological presentation of ""de novo"" created vascular network that dynamically involves the entire connective tissue stroma of the uterine cervix."	D002583	Uterine Cervical Neoplasms
FLT1	14674128	[Correlation between transcriptional activity of vascular endothelial growth factor (VEFG) and transcriptional activity of its receptors (FLT-1 and FLK-1) in low-grade squamous intraepithelial lesions (LSIL) of uterine cervix].	"In this report we focus on angiogenesis, as one component of a complex molecular relations in the process of neovascularisation in the low-grade intraepithelial changes (LSIL). Increasing number of publications indicates that the interrelation between isoforms of VEGF (VEGF121, VEGF145, VEGF165, VEGF183, VEGF189, VEGF206) but not total VEGF is responsible for angiogenesis, both in physiological and pathological processes. The molecular co-operation of the said isoforms and their receptors results in morphological presentation of ""de novo"" created vascular network that dynamically involves the entire connective tissue stroma of the uterine cervix."	D002578	Uterine Cervical Dysplasia
FLT1	18593464	Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.	Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis.	D001172	Arthritis, Rheumatoid
FLT1	18593464	Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.	Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis.	D004195	Disease Models, Animal

Clinically important variants in FLT1

(ClinVar, 04/20/2024)

accession_id	uniprot_id	gene_name	Type	Variant	Clinical_significance
P17948	P17948-1	FLT1;LOC126861720	Insertion	p.Ser1015fs	not provided
P17948	P17948-1	FLT1;LOC126861720	Insertion	p.Ser1015fs	not provided
P17948	P17948-1	FLT1	Insertion	p.Gly886fs	not provided
P17948	P17948-1	FLT1	Insertion	p.Gly886fs	not provided
P17948	P17948-1	FLT1	single nucleotide variant	p.Cys1110Ser	not provided
P17948	P17948-1	FLT1	single nucleotide variant	p.Cys1110Ser	not provided
P17948	P17948-1	FLT1	Deletion	p.Tyr815fs	Uncertain significance
P17948	P17948-1	FLT1	Deletion	p.Tyr815fs	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met938Val	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Met938Val	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Pro1201Leu	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Pro1201Leu	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile548Met	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile548Met	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Asp6Asn	Benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Asp6Asn	Benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu1032Asp	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu1032Asp	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gln341Arg	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gln341Arg	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala1200Val	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala1200Val	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gly988Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gly988Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg528Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg528Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Val211Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Val211Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Pro688Ala	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Pro688Ala	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Val2Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Val2Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Leu248Phe	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Leu248Phe	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met624Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met624Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gly866Arg	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Gly866Arg	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala1188Asp	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala1188Asp	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Asn685Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Asn685Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala434Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala434Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Lys565Glu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Lys565Glu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.His887Asn	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.His887Asn	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ser285Arg	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Ser285Arg	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala381Pro	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ala381Pro	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile291Val	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile291Val	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Met945Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met945Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met600Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Met600Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg159Gln	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg159Gln	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu689Lys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu689Lys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr421Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr421Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.His288Leu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.His288Leu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg183Cys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg183Cys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile1019Val	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile1019Val	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu70Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Glu70Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr594Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr594Ile	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr654Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Thr654Ser	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Asp495Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Asp495Gly	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Tyr1309Cys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Tyr1309Cys	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile405Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Ile405Thr	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Phe88Leu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Phe88Leu	Uncertain significance
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg54Ser	Likely benign
P17948	P17948-1	FLT1	single nucleotide variant	p.Arg54Ser	Likely benign