Protein:FLT3 |
Protein Summary |
 Gene summary |
| Gene name: FLT3 | ASpdb.0 ID: 2322 | Gene | Gene symbol | FLT3 | Gene ID | 2322 |
| Gene name | fms related receptor tyrosine kinase 3 |
| Synonyms | CD135|FLK-2|FLK2|STK1 |
| Cytomap | 13q12.2 |
| Type of gene | protein-coding |
| Description | receptor-type tyrosine-protein kinase FLT3CD135 antigenFL cytokine receptorfetal liver kinase 2fms related tyrosine kinase 3fms-like tyrosine kinase 3growth factor receptor tyrosine kinase type IIIstem cell tyrosine kinase 1 |
| Modification date | 20240411 |
| UniProtAcc | P36888 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | FLT3 | GO:0005783 | endoplasmic reticulum | - |
| Gene | FLT3 | GO:0030097 | hemopoiesis | 7507245 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P36888-1 | P36888-1_3qs9_E.pdb | 3QS9 | X-ray | 7.8 | E | 79 | 529 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P36888 | FLT3 | P36888-1 | P36888-2 | 993 | 952 | 807 | 847 | Deletion | none | none | 806 | 806 |
| Multiple sequence alignment of our canonical and alternatively spliced FLT3 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FLT3 |
| UniProt-id | ENSG | ENST | ENSP |
| P36888-1 | ENSG00000122025.15 | ENST00000241453.12 | ENSP00000241453.7 |
| UniProt-id | NM ID | NP ID |
| P36888-1 | NM_004119.2 | NP_004110.2 |
| Amino acid sequences of our canonical and alternatively spliced FLT3 |
| accession_id | Protein sequence |
| P36888-1 | MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASIT LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWI RCKAVHVNHGFGLTWELENKALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQA SCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAY GISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHR DLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLSPQAQV |
| P36888-2 | MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASIT LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQTTLPQLFLKVGEPLWI RCKAVHVNHGFGLTWELENKALEEGNYFEMSTYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQA SCFSDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAY GISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSARLP VKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTS |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| FLT3 (go to UniProt):P36888 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P36888 | Topological domain | 564 | 993 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=807;End=847 |
| P36888 | Domain | 610 | 943 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Deletion;Start=807;End=847 |
Gene Isoform Structures and Expression Levels for FLT3 |
| Gene structures of our canonical and alternative spliced genes of FLT3 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P36888-1 |
| 3D view using mol* of P36888-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P36888-1 |
 |
| pLDDT distribution across the protein length of P36888-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P36888-1 |
 |
| Ramachandran plot of P36888-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P36888-1 | 1.051 | 186 | 1.079 | 473.683 | 0.534 | 0.747 | 0.966 | 0.835 | 0.949 | 0.88 | 1.277 | 570,571,572,573,574,575,576,577,578,591,592,593,59 4,595,619,620,621,644,653,656,657,660,661,664,810, 811,816,829,831,832,834,835,836,837,842,847,848,84 9,850,851,865 |
| P36888-2 | 1.072 | 200 | 1.142 | 928.501 | 0.718 | 0.696 | 0.784 | 0.95 | 0.662 | 1.436 | 1.883 | 576,672,673,674,694,696,697,698,699,700,702,703,71 4,717,718,721,723,724,725,726,727,728,729,731,777, 780,781,782,783,784,786,787,790,791,794,795,798,79 9,802,805,806,807,809,813,826,829,832,833,836,839, 840,906,910,913,914 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P36888-1_P36888-1_3qs9_E.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P36888-1_3qs9_E_P36888-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P36888-1_P36888-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P36888-1_vs_P36888-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P36888-1_vs_P36888-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to FLT3 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P36888 | FLT3 | DB05014 | XL999 | investigational | |
| P36888 | FLT3 | DB06080 | Linifanib | investigational | |
| P36888 | FLT3 | DB12874 | Quizartinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB12500 | Fedratinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB12742 | Amuvatinib | investigational | |
| P36888 | FLT3 | DB09079 | Nintedanib | approved | inhibitor |
| P36888 | FLT3 | DB05465 | Tandutinib | investigational | |
| P36888 | FLT3 | DB12978 | Pexidartinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB12010 | Fostamatinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB12267 | Brigatinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB12141 | Gilteritinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB08901 | Ponatinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB06595 | Midostaurin | approved, investigational | antagonist, inhibitor |
| P36888 | FLT3 | DB01268 | Sunitinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB06469 | Lestaurtinib | investigational | |
| P36888 | FLT3 | DB00398 | Sorafenib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB11763 | Momelotinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB11697 | Pacritinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB15822 | Pralsetinib | approved, investigational | inhibitor |
| P36888 | FLT3 | DB11800 | Tivozanib | approved, investigational | inhibitor |
Related Diseases to FLT3 |
| Previous studies relating to the alternative splicing of FLT3 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| FLT3 | 24574459 | NOTCH2 and FLT3 gene mis-splicings are common events in patients with acute myeloid leukemia (AML): new potential targets in AML. | Our previous studies revealed an increase in alternative splicing of multiple RNAs in cells from patients with acute myeloid leukemia (AML) compared with CD34(+) bone marrow cells from normal donors. Aberrantly spliced genes included a number of oncogenes, tumor suppressor genes, and genes involved in regulation of apoptosis, cell cycle, and cell differentiation. Among the most commonly mis-spliced genes (>70% of AML patients) were 2, NOTCH2 and FLT3, that encode myeloid cell surface proteins. The splice variants of NOTCH2 and FLT3 resulted from complete or partial exon skipping and utilization of cryptic splice sites. Longitudinal analyses suggested that NOTCH2 and FLT3 aberrant splicing correlated with disease status. Correlation analyses between splice variants of these genes and clinical features of patients showed an association between NOTCH2-Va splice variant and overall survival of patients. Our results suggest that NOTCH2 and FLT3 mis-splicing is a common characteristic of AML and has the potential to generate transcripts encoding proteins with altered function. Thus, splice variants of these genes might provide disease markers and targets for novel therapeutics. | D015470 | Leukemia, Myeloid, Acute |
Clinically important variants in FLT3 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |