Protein:SIRT1 |
Protein Summary |
 Gene summary |
| Gene name: SIRT1 | ASpdb.0 ID: 23411 | Gene | Gene symbol | SIRT1 | Gene ID | 23411 |
| Gene name | sirtuin 1 |
| Synonyms | SIR2|SIR2L1|SIR2alpha |
| Cytomap | 10q21.3 |
| Type of gene | protein-coding |
| Description | NAD-dependent protein deacetylase sirtuin-1NAD-dependent protein deacylase sirtuin-1SIR2-like protein 1regulatory protein SIR2 homolog 1sirtuin type 1 |
| Modification date | 20240416 |
| UniProtAcc | Q96EB6 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | SIRT1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 12535671|15692560|20955178 |
| Gene | SIRT1 | GO:0000183 | rDNA heterochromatin formation | 18485871 |
| Gene | SIRT1 | GO:0000785 | chromatin | 17505061|22956909 |
| Gene | SIRT1 | GO:0000791 | euchromatin | 15469825 |
| Gene | SIRT1 | GO:0000792 | heterochromatin | 15469825 |
| Gene | SIRT1 | GO:0001525 | angiogenesis | 20620956 |
| Gene | SIRT1 | GO:0001650 | fibrillar center | - |
| Gene | SIRT1 | GO:0002821 | positive regulation of adaptive immune response | 21890893 |
| Gene | SIRT1 | GO:0003714 | transcription corepressor activity | 12535671 |
| Gene | SIRT1 | GO:0005634 | nucleus | 11672523|19934257|20027304|20167603|20955178 |
| Gene | SIRT1 | GO:0005635 | nuclear envelope | 15469825 |
| Gene | SIRT1 | GO:0005637 | nuclear inner membrane | 15469825 |
| Gene | SIRT1 | GO:0005654 | nucleoplasm | 16079181 |
| Gene | SIRT1 | GO:0005677 | chromatin silencing complex | 18485871 |
| Gene | SIRT1 | GO:0005730 | nucleolus | 16079181 |
| Gene | SIRT1 | GO:0005730 | nucleolus | 15469825|18485871 |
| Gene | SIRT1 | GO:0005737 | cytoplasm | 15469825 |
| Gene | SIRT1 | GO:0005737 | cytoplasm | 20027304 |
| Gene | SIRT1 | GO:0005739 | mitochondrion | - |
| Gene | SIRT1 | GO:0005829 | cytosol | 20027304 |
| Gene | SIRT1 | GO:0005829 | cytosol | - |
| Gene | SIRT1 | GO:0006476 | protein deacetylation | 18203716|18662546|20027304|20955178|31722219 |
| Gene | SIRT1 | GO:0006974 | DNA damage response | 18203716 |
| Gene | SIRT1 | GO:0006979 | response to oxidative stress | 14976264 |
| Gene | SIRT1 | GO:0007179 | transforming growth factor beta receptor signaling pathway | 23960241 |
| Gene | SIRT1 | GO:0007346 | regulation of mitotic cell cycle | 15692560 |
| Gene | SIRT1 | GO:0010824 | regulation of centrosome duplication | 31722219 |
| Gene | SIRT1 | GO:0010868 | negative regulation of triglyceride biosynthetic process | 29765047 |
| Gene | SIRT1 | GO:0016239 | positive regulation of macroautophagy | 18296641 |
| Gene | SIRT1 | GO:0016567 | protein ubiquitination | 21841822 |
| Gene | SIRT1 | GO:0016605 | PML body | 12006491 |
| Gene | SIRT1 | GO:0017136 | NAD-dependent histone deacetylase activity | 12006491|15469825|16079181|16959573|28497810 |
| Gene | SIRT1 | GO:0019213 | deacetylase activity | 18203716 |
| Gene | SIRT1 | GO:0031507 | heterochromatin formation | 15469825 |
| Gene | SIRT1 | GO:0032041 | NAD-dependent histone H3K14 deacetylase activity | 15469825 |
| Gene | SIRT1 | GO:0032088 | negative regulation of NF-kappaB transcription factor activity | 15152190 |
| Gene | SIRT1 | GO:0033553 | rDNA heterochromatin | 18485871 |
| Gene | SIRT1 | GO:0033558 | protein lysine deacetylase activity | 19934257|20027304|21807113|23056314 |
| Gene | SIRT1 | GO:0034979 | NAD-dependent protein deacetylase activity | 15692560|20100829|20955178|21775285|23142079|29765047|30193097|30409912|32034146|32538779 |
| Gene | SIRT1 | GO:0035098 | ESC/E(Z) complex | 15684044 |
| Gene | SIRT1 | GO:0042542 | response to hydrogen peroxide | 19934257 |
| Gene | SIRT1 | GO:0043065 | positive regulation of apoptotic process | 15152190 |
| Gene | SIRT1 | GO:0043124 | negative regulation of canonical NF-kappaB signal transduction | 17680780 |
| Gene | SIRT1 | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 11672523|20955178 |
| Gene | SIRT1 | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator | 11672523 |
| Gene | SIRT1 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 23960241 |
| Gene | SIRT1 | GO:0045348 | positive regulation of MHC class II biosynthetic process | 21890893 |
| Gene | SIRT1 | GO:0045722 | positive regulation of gluconeogenesis | 15692560|23142079|30193097 |
| Gene | SIRT1 | GO:0045766 | positive regulation of angiogenesis | 23960241|25217442 |
| Gene | SIRT1 | GO:0045892 | negative regulation of DNA-templated transcription | 11672523|20074560 |
| Gene | SIRT1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 12837246|21807113 |
| Gene | SIRT1 | GO:0046628 | positive regulation of insulin receptor signaling pathway | 21241768 |
| Gene | SIRT1 | GO:0046969 | NAD-dependent histone H3K9 deacetylase activity | 15469825 |
| Gene | SIRT1 | GO:0046970 | NAD-dependent histone H4K16 deacetylase activity | 15469825 |
| Gene | SIRT1 | GO:0051097 | negative regulation of helicase activity | 18203716 |
| Gene | SIRT1 | GO:0051658 | maintenance of nucleus location | 15692560 |
| Gene | SIRT1 | GO:0070301 | cellular response to hydrogen peroxide | 20027304 |
| Gene | SIRT1 | GO:0070577 | lysine-acetylated histone binding | 15469825 |
| Gene | SIRT1 | GO:0071356 | cellular response to tumor necrosis factor | 15152190 |
| Gene | SIRT1 | GO:0140861 | DNA repair-dependent chromatin remodeling | 20100829 |
| Gene | SIRT1 | GO:0140937 | histone H4K12 deacetylase activity | 15469825 |
| Gene | SIRT1 | GO:0141050 | histone H3K deacetylase activity | 20027304 |
| Gene | SIRT1 | GO:0160012 | NAD-dependent histone decrotonylase activity | 28497810 |
| Gene | SIRT1 | GO:2000480 | negative regulation of cAMP-dependent protein kinase activity | 20203304 |
| Gene | SIRT1 | GO:2000757 | negative regulation of peptidyl-lysine acetylation | 20100829 |
| Gene | SIRT1 | GO:2000773 | negative regulation of cellular senescence | 20203304 |
| Gene | SIRT1 | GO:2000774 | positive regulation of cellular senescence | 18687677 |
| Gene | SIRT1 | GO:2000781 | positive regulation of double-strand break repair | 32538779 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q96EB6-1 | Q96EB6-1_5btr_B.pdb | 5BTR | X-ray | 3.2 | B | 143 | 515 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q96EB6 | SIRT1 | Q96EB6-1 | Q96EB6-2 | 747 | 561 | 454 | 639 | Deletion | none | none | 453 | 453 |
| Multiple sequence alignment of our canonical and alternatively spliced SIRT1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of SIRT1 |
| UniProt-id | ENSG | ENST | ENSP |
| Q96EB6-1 | ENSG00000096717.12 | ENST00000212015.11 | ENSP00000212015.6 |
| UniProt-id | NM ID | NP ID |
| Q96EB6-1 | NM_012238.4 | NP_036370.2 |
| Amino acid sequences of our canonical and alternatively spliced SIRT1 |
| accession_id | Protein sequence |
| Q96EB6-1 | MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQ EAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGI PDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVAL IPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAK EQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD |
| Q96EB6-2 | MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQ EAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGI PDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVAL IPSNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEA |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| SIRT1 (go to UniProt):Q96EB6 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q96EB6 | Domain | 236 | 496 | Note=Deacetylase sirtuin-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00236 | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Region | 143 | 541 | Note=Interaction with CCAR2 | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Region | 523 | 549 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Region | 538 | 540 | Note=Phosphorylated at one of three serine residues | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Region | 562 | 587 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Compositional bias | 532 | 549 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=454;End=639 |
| Q96EB6 | Compositional bias | 563 | 583 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=454;End=639 |
Gene Isoform Structures and Expression Levels for SIRT1 |
| Gene structures of our canonical and alternative spliced genes of SIRT1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q96EB6-1 |
| 3D view using mol* of Q96EB6-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q96EB6-1 |
 |
| pLDDT distribution across the protein length of Q96EB6-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q96EB6-1 |
 |
| Ramachandran plot of Q96EB6-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q96EB6-1 | 1.044 | 593 | 1.081 | 1818.586 | 0.57 | 0.723 | 0.924 | 0.744 | 0.9 | 0.827 | 0.708 | 153,154,155,156,157,158,159,162,202,206,209,211,21 2,213,214,215,220,223,226,227,228,230,231,232,233, 261,262,263,264,265,266,267,270,271,272,273,274,27 5,276,277,278,279,280,291,292,294,295,297,298,299, 300,301,304,316,325,326,345,346,347,348,363,411,41 2,413,414,415,416,417,418,422,423,426,427,430,440, 441,442,443,444,445,446,447,449,450,451,453,454,45 7,465,466,467,471,472,481,482,483,484,487,488,491, 502,503,505,506,507,632,635,639,640,654,656 |
| Q96EB6-2 | 1.056 | 248 | 1.065 | 566.979 | 0.546 | 0.782 | 0.94 | 0.583 | 1.054 | 0.553 | 0.466 | 83,84,86,87,90,261,262,263,266,267,270,271,272,273 ,274,275,276,277,278,280,294,297,345,346,347,348,3 63,411,412,413,414,415,416,418,439,440,441,442,443 ,444,445,446,447,448,449,470 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q96EB6-1_Q96EB6-1_5btr_B.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q96EB6-1_5btr_B_Q96EB6-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q96EB6-1_Q96EB6-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q96EB6-1_vs_Q96EB6-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q96EB6-1_vs_Q96EB6-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q96EB6 | Region | 143 | 541 | Note=Interaction with CCAR2 | Type=Deletion;Start=454;End=639 |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to SIRT1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| Q96EB6 | SIRT1 | DB15493 | Cambinol | experimental | inhibitor |
| Q96EB6 | SIRT1 | DB13978 | Selisistat | experimental | inhibitor |
| Q96EB6 | SIRT1 | DB02709 | Resveratrol | investigational |
Related Diseases to SIRT1 |
| Previous studies relating to the alternative splicing of SIRT1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
Clinically important variants in SIRT1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |