ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures
ASpdb Logo

Home

Download

Statistics

Examples

Help

Contact

Terms of Use

Center for Computational Systems Medicine
leaf

Protein Summary

leaf

AS Summary

leaf

Protein Functional Features

leaf

Gene Isoform Structures and Expression Levels

leaf

Protein Structures

leaf

pLDDT Score Distribution

leaf

Ramachandran Plot of Protein Structures

leaf

Potential Active Site Information

leaf

Protein Structure and Feature Comparision

leaf

Protein-Protein Interaction

leaf

Related Drugs

leaf

Related Diseases

leaf

Clinically Important Variants

Protein:SF3B1

Protein Summary

check button Gene summary
Gene name: SF3B1
ASpdb.0 ID: 23451
Gene
Gene symbol

SF3B1

Gene ID

23451

Gene namesplicing factor 3b subunit 1
SynonymsHsh155|MDS|PRP10|PRPF10|SAP155|SF3b155
Cytomap

2q33.1

Type of geneprotein-coding
Descriptionsplicing factor 3B subunit 1pre-mRNA processing 10pre-mRNA splicing factor SF3b, 155 kDa subunitspliceosome-associated protein 155splicing factor 3b, subunit 1, 155kDa
Modification date20240407
UniProtAcc

O75533


check button Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
GeneSF3B1

GO:0000398

mRNA splicing, via spliceosome

11252167

GeneSF3B1

GO:0000398

mRNA splicing, via spliceosome

27720643|28781166|29360106|32494006|34822310|36797247

GeneSF3B1

GO:0003723

RNA binding

27720643

GeneSF3B1

GO:0005634

nucleus

18559850|27720643|28541300|28781166|29360106

GeneSF3B1

GO:0005684

U2-type spliceosomal complex

32494006|34822310|36797247

GeneSF3B1

GO:0005686

U2 snRNP

11252167

GeneSF3B1

GO:0005689

U12-type spliceosomal complex

15146077

GeneSF3B1

GO:0016607

nuclear speck

-

GeneSF3B1

GO:0034693

U11/U12 snRNP

11252167

GeneSF3B1

GO:0045945

positive regulation of transcription by RNA polymerase III

16603771

GeneSF3B1

GO:0071005

U2-type precatalytic spliceosome

28781166|29360106

GeneSF3B1

GO:0071013

catalytic step 2 spliceosome

11991638

GeneSF3B1

GO:0110016

B-WICH complex

16603771

GeneSF3B1

GO:1990935

splicing factor binding

27720643



AS Summary

check button Information of the canonical protein with experimentally identified structure from PDB (2023).
UniProt AccFile namePDB IDMethodResolutionChainStartEnd
O75533-1O75533-1_5z58_1.pdb5Z58EM4.91821304

check button ASpdb's canonical and alternatively spliced isoform information.
accession_idgene_namecanonical_idalternative_idcanonical_lengthalternative_lengthcanonical_startcanonical_endtypeoriginalSEQvariationSEQalternative_startalternative_end
O75533SF3B1O75533-1O75533-21304144140144SubstitutionGKTPDFYSAA140144
O75533SF3B1O75533-1O75533-213041441451304Deletionnonenone144144

check buttonMultiple sequence alignment of our canonical and alternatively spliced SF3B1

check button Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of SF3B1
UniProt-idENSGENSTENSP
O75533-1ENSG00000115524.17ENST00000335508.11ENSP00000335321.6
O75533-2ENSG00000115524.17ENST00000409915.8ENSP00000428820.1
O75533-2ENSG00000115524.17ENST00000414963.2ENSP00000402997.2

UniProt-idNM IDNP ID
O75533-1NM_012433.3NP_036565.2

check buttonAmino acid sequences of our canonical and alternatively spliced SF3B1
accession_idProtein sequence
O75533-1MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVAL
LNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGR
GDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI
GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTED
RTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM
SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTAR
AFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEI
LPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF
QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVL
GSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT
FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVT
PLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK
O75533-2MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVAL

Protein Functional Features

check buttonMain function of this protein. (from UniProt)
SF3B1 (go to UniProt):O75533

check buttonRetention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

* Minus value of BPloci means that the break pointn is located before the CDS.
- Retained protein feature among the 13 regional features.
Accession_idSubsectionStartEndFuncitonal featureSplicing information
O75533Repeat529568Note=HEAT 1Type=Deletion;Start=145;End=1304
O75533Repeat569603Note=HEAT 2Type=Deletion;Start=145;End=1304
O75533Repeat604641Note=HEAT 3Type=Deletion;Start=145;End=1304
O75533Repeat643677Note=HEAT 4Type=Deletion;Start=145;End=1304
O75533Repeat680718Note=HEAT 5Type=Deletion;Start=145;End=1304
O75533Repeat763801Note=HEAT 6Type=Deletion;Start=145;End=1304
O75533Repeat843881Note=HEAT 7Type=Deletion;Start=145;End=1304
O75533Repeat10101048Note=HEAT 8Type=Deletion;Start=145;End=1304
O75533Repeat10521090Note=HEAT 9Type=Deletion;Start=145;End=1304
O75533Repeat11221160Note=HEAT 10Type=Deletion;Start=145;End=1304
O75533Repeat11631201Note=HEAT 11Type=Deletion;Start=145;End=1304
O75533Region124148Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Substitution;Start=140;End=144
O75533Region124148Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Deletion;Start=145;End=1304
O75533Region173360Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Deletion;Start=145;End=1304
O75533Region190342Note=U2AF homology region%3B mediates interaction with RBM39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24795046;Dbxref=PMID:24795046Type=Deletion;Start=145;End=1304
O75533Region223491Note=Interaction with PPP1R8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:12105215;Dbxref=PMID:12105215Type=Deletion;Start=145;End=1304
O75533Region529568Note=Interaction with SF3B14Type=Deletion;Start=145;End=1304
O75533Region547550Note=Interaction with PHF5A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304
O75533Region11561157Note=Interaction with PHF5A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304
O75533Region12481304Note=Interaction with SF3B3 and SF3B5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304
O75533Compositional bias204224Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Deletion;Start=145;End=1304
O75533Compositional bias342356Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Deletion;Start=145;End=1304


Gene Isoform Structures and Expression Levels for SF3B1

check buttonGene structures of our canonical and alternative spliced genes of SF3B1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
gene isoform structure of SF3B1

check button Expression levels of gene isoforms across GTEx.
gtex expression

check button Expression levels of gene isoforms across TCGA.
tcga expression


Protein Structures

check button PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.
3D view using mol* of O75533-1
3D view using mol* of O75533-2


pLDDT Score Distribution

check button pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.
pLDDT distribution across the protein length of O75533-1
all structure
pLDDT distribution across the protein length of O75533-2
all structure


Ramachandran Plot of Protein Structures


check button Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.
Ramachandran plot of O75533-1
all structure
Ramachandran plot of O75533-2
all structure

Potential Active Site Information


check button The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.
UniProt-idSite scoreSizeD scoreVolumeExposureEnclosureContactPhobicPhilicBalanceDon/AccResidues
O75533-11.0331431.081392.0490.5710.6870.8720.9190.8311.1071.38173,74,75,76,77,662,666,699,700,703,704,707,714,741
,744,745,748,752,783,786,787,790,791,793,827,828,8
30,831,832,835,870
O75533-20.354100.2635.4880.7620.4510.6860.0470.9350.0514.23322,25,27

Protein Structure and Feature Comparision


check button Protein Structure Comparision Using Template Modeling Scores (TM-score).
all structure

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)
3D view using mol* of O75533-1_O75533-1_5z58_1.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of O75533-1_5z58_1_O75533-2.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of O75533-1_O75533-2.pdb

check button Protein Feature Comparison of the protein sequendary structures among the protiens.
./stats/secondary_structure/figure/O75533-1_vs_O75533-2.png
all structure<

check button Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.
./stats/relative_asa/O75533-1_vs_O75533-2.png
all structure<


Protein-Protein Interaction


check button Interactors from UniProt.
Accession_idSubsectionStartEndFuncitonal featureSplicing information
O75533Region190342Note=U2AF homology region%3B mediates interaction with RBM39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24795046;Dbxref=PMID:24795046Type=Deletion;Start=145;End=1304
O75533Region223491Note=Interaction with PPP1R8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:12105215;Dbxref=PMID:12105215Type=Deletion;Start=145;End=1304
O75533Region529568Note=Interaction with SF3B14Type=Deletion;Start=145;End=1304
O75533Region547550Note=Interaction with PHF5A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304
O75533Region11561157Note=Interaction with PHF5A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304
O75533Region12481304Note=Interaction with SF3B3 and SF3B5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:27720643;Dbxref=PMID:27720643Type=Deletion;Start=145;End=1304


check button Interactors from STRING.
Gene nameInteractors


Related Drugs to SF3B1


check button Drugs targeting this gene/protein.
(DrugBank)
UniProt accessionGene nameDrugBank IDDrug nameDrug groupActions
O75533SF3B1DB14017H3B-8800investigationalinhibitor

Related Diseases to SF3B1


check button Previous studies relating to the alternative splicing of SF3B1 and disease information from the MeSH term (PubMed)
GenePMIDTitleAbstractMeSH IDMeSH term
SF3B123861464SF3B1 mutations are associated with alternative splicing in uveal melanoma.Uveal melanoma, the most common eye malignancy, causes severe visual morbidity and is fatal in approximately 50% of patients. Primary uveal melanoma can be cured by surgery or radiotherapy, but the metastatic disease is treatment refractory. To understand comprehensively uveal melanoma genetics, we conducted single-nucleotide polymorphism arrays and whole-genome sequencing on 12 primary uveal melanomas. We observed only approximately 2,000 predicted somatic single-nucleotide variants per tumor and low levels of aneuploidy. We did not observe an ultraviolet radiation DNA damage signature, but identified SF3B1 mutations in three samples and a further 15 mutations in an extension cohort of 105 samples. SF3B1 mutations were associated with good prognosis and were rarely coincident with BAP1 mutations. SF3B1 encodes a component of the spliceosome, and RNA sequencing revealed that SF3B1 mutations were associated with differential alternative splicing of protein coding genes, including ABCC5 and UQCC, and of the long noncoding RNA CRNDE.D008545Melanoma
SF3B123861464SF3B1 mutations are associated with alternative splicing in uveal melanoma.Uveal melanoma, the most common eye malignancy, causes severe visual morbidity and is fatal in approximately 50% of patients. Primary uveal melanoma can be cured by surgery or radiotherapy, but the metastatic disease is treatment refractory. To understand comprehensively uveal melanoma genetics, we conducted single-nucleotide polymorphism arrays and whole-genome sequencing on 12 primary uveal melanomas. We observed only approximately 2,000 predicted somatic single-nucleotide variants per tumor and low levels of aneuploidy. We did not observe an ultraviolet radiation DNA damage signature, but identified SF3B1 mutations in three samples and a further 15 mutations in an extension cohort of 105 samples. SF3B1 mutations were associated with good prognosis and were rarely coincident with BAP1 mutations. SF3B1 encodes a component of the spliceosome, and RNA sequencing revealed that SF3B1 mutations were associated with differential alternative splicing of protein coding genes, including ABCC5 and UQCC, and of the long noncoding RNA CRNDE.D014604Uveal Neoplasms
SF3B124711643Identifying biological pathways that underlie primordial short stature using network analysis.Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.D004392Dwarfism
SF3B124711643Identifying biological pathways that underlie primordial short stature using network analysis.Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.D006130Growth Disorders
SF3B124711643Identifying biological pathways that underlie primordial short stature using network analysis.Mutations in CUL7, OBSL1 and CCDC8, leading to disordered ubiquitination, cause one of the commonest primordial growth disorders, 3-M syndrome. This condition is associated with i) abnormal p53 function, ii) GH and/or IGF1 resistance, which may relate to failure to recycle signalling molecules, and iii) cellular IGF2 deficiency. However the exact molecular mechanisms that may link these abnormalities generating growth restriction remain undefined. In this study, we have used immunoprecipitation/mass spectrometry and transcriptomic studies to generate a 3-M 'interactome', to define key cellular pathways and biological functions associated with growth failure seen in 3-M. We identified 189 proteins which interacted with CUL7, OBSL1 and CCDC8, from which a network including 176 of these proteins was generated. To strengthen the association to 3-M syndrome, these proteins were compared with an inferred network generated from the genes that were differentially expressed in 3-M fibroblasts compared with controls. This resulted in a final 3-M network of 131 proteins, with the most significant biological pathway within the network being mRNA splicing/processing. We have shown using an exogenous insulin receptor (INSR) minigene system that alternative splicing of exon 11 is significantly changed in HEK293 cells with altered expression of CUL7, OBSL1 and CCDC8 and in 3-M fibroblasts. The net result is a reduction in the expression of the mitogenic INSR isoform in 3-M syndrome. From these preliminary data, we hypothesise that disordered ubiquitination could result in aberrant mRNA splicing in 3-M; however, further investigation is required to determine whether this contributes to growth failure.D009123Muscle Hypotonia
SF3B126842708Cancer-associated SF3B1 mutations affect alternative splicing by promoting alternative branchpoint usage.Hotspot mutations in the spliceosome gene SF3B1 are reported in ∼20% of uveal melanomas. SF3B1 is involved in 3'-splice site (3'ss) recognition during RNA splicing; however, the molecular mechanisms of its mutation have remained unclear. Here we show, using RNA-Seq analyses of uveal melanoma, that the SF3B1(R625/K666) mutation results in deregulated splicing at a subset of junctions, mostly by the use of alternative 3'ss. Modelling the differential junctions in SF3B1(WT) and SF3B1(R625/K666) cell lines demonstrates that the deregulated splice pattern strictly depends on SF3B1 status and on the 3'ss-sequence context. SF3B1(WT) knockdown or overexpression do not reproduce the SF3B1(R625/K666) splice pattern, qualifying SF3B1(R625/K666) as change-of-function mutants. Mutagenesis of predicted branchpoints reveals that the SF3B1(R625/K666)-promoted splice pattern is a direct result of alternative branchpoint usage. Altogether, this study provides a better understanding of the mechanisms underlying splicing alterations induced by mutant SF3B1 in cancer, and reveals a role for alternative branchpoints in disease.D008545Melanoma
SF3B126842708Cancer-associated SF3B1 mutations affect alternative splicing by promoting alternative branchpoint usage.Hotspot mutations in the spliceosome gene SF3B1 are reported in ∼20% of uveal melanomas. SF3B1 is involved in 3'-splice site (3'ss) recognition during RNA splicing; however, the molecular mechanisms of its mutation have remained unclear. Here we show, using RNA-Seq analyses of uveal melanoma, that the SF3B1(R625/K666) mutation results in deregulated splicing at a subset of junctions, mostly by the use of alternative 3'ss. Modelling the differential junctions in SF3B1(WT) and SF3B1(R625/K666) cell lines demonstrates that the deregulated splice pattern strictly depends on SF3B1 status and on the 3'ss-sequence context. SF3B1(WT) knockdown or overexpression do not reproduce the SF3B1(R625/K666) splice pattern, qualifying SF3B1(R625/K666) as change-of-function mutants. Mutagenesis of predicted branchpoints reveals that the SF3B1(R625/K666)-promoted splice pattern is a direct result of alternative branchpoint usage. Altogether, this study provides a better understanding of the mechanisms underlying splicing alterations induced by mutant SF3B1 in cancer, and reveals a role for alternative branchpoints in disease.D014604Uveal Neoplasms


Clinically important variants in SF3B1


check button (ClinVar, 04/20/2024)
accession_iduniprot_idgene_nameTypeVariantClinical_significance