ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:FOSB

Protein Summary

Gene summary

Gene name: FOSB
ASpdb.0 ID: 2354
	Gene
Gene symbol	FOSB
Gene ID	2354
Gene name	FosB proto-oncogene, AP-1 transcription factor subunit
Synonyms	AP-1\|G0S3\|GOS3\|GOSB
Cytomap	19q13.32
Type of gene	protein-coding
Description	protein FosBFBJ murine osteosarcoma viral oncogene homolog BFosB proto-oncogene, AP-1 trancription factor subunitG0/G1 switch regulatory protein 3activator protein 1transcription factor AP-1 subunit FosB
Modification date	20240411
UniProtAcc	P53539

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	FOSB	GO:0005634	nucleus	22387553
Gene	FOSB	GO:0005654	nucleoplasm	-
Gene	FOSB	GO:0043231	intracellular membrane-bounded organelle	-
Gene	FOSB	GO:1990837	sequence-specific double-stranded DNA binding	28473536

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
P53539-1	P53539-1_6uci_D.pdb	6UCI	X-ray	2.09	D	153	219

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
P53539	FOSB	P53539-1	P53539-10	338	289	1	49	Deletion	none	none	0	0
P53539	FOSB	P53539-1	P53539-2	338	302	150	185	Deletion	none	none	149	149
P53539	FOSB	P53539-1	P53539-3	338	299	42	80	Deletion	none	none	41	41
P53539	FOSB	P53539-1	P53539-4	338	291	238	284	Deletion	none	none	237	237
P53539	FOSB	P53539-1	P53539-5	338	263	42	80	Deletion	none	none	41	41
P53539	FOSB	P53539-1	P53539-5	338	263	150	185	Deletion	none	none	110	110
P53539	FOSB	P53539-1	P53539-6	338	255	150	185	Deletion	none	none	149	149
P53539	FOSB	P53539-1	P53539-6	338	255	238	284	Deletion	none	none	201	201
P53539	FOSB	P53539-1	P53539-7	338	252	42	80	Deletion	none	none	41	41
P53539	FOSB	P53539-1	P53539-7	338	252	238	284	Deletion	none	none	198	198
P53539	FOSB	P53539-1	P53539-8	338	195	43	185	Deletion	none	none	42	42
P53539	FOSB	P53539-1	P53539-9	338	148	43	185	Deletion	none	none	42	42
P53539	FOSB	P53539-1	P53539-9	338	148	238	284	Deletion	none	none	94	94

Multiple sequence alignment of our canonical and alternatively spliced FOSB

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FOSB

UniProt-id	ENSG	ENST	ENSP
P53539-1	ENSG00000125740.15	ENST00000353609.8	ENSP00000245919.3
P53539-10	ENSG00000125740.15	ENST00000586615.5	ENSP00000468207.1
P53539-2	ENSG00000125740.15	ENST00000417353.6	ENSP00000407207.1
P53539-3	ENSG00000125740.15	ENST00000591858.5	ENSP00000466530.1
P53539-5	ENSG00000125740.15	ENST00000585836.5	ENSP00000467497.1
P53539-8	ENSG00000125740.15	ENST00000443841.6	ENSP00000414177.1

UniProt-id	NM ID	NP ID
P53539-1	NM_006732.2	NP_006723.2
P53539-2	NM_001114171.1	NP_001107643.1

Amino acid sequences of our canonical and alternatively spliced FOSB

accession_id	Protein sequence
P53539-1	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQ PPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQ
P53539-10	MPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPAR ARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEG PGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQR
P53539-2	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQ PPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLV AHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVL
P53539-3	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTT SGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHK PGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCP
P53539-4	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQ PPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGA
P53539-5	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTT SGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWL
P53539-6	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQ PPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLV
P53539-7	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTT SGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHK
P53539-8	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPG PLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGS
P53539-9	MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPG

Protein Functional Features

Main function of this protein. (from UniProt)

FOSB (go to UniProt):P53539

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
P53539	Domain	155	218	Note=BZIP;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Domain	155	218	Note=BZIP;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Domain	155	218	Note=BZIP;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Domain	155	218	Note=BZIP;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Domain	155	218	Note=BZIP;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=1;End=49
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Region	1	54	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=42;End=80
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Region	79	191	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Region	157	182	Note=Basic motif;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	157	182	Note=Basic motif;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	157	182	Note=Basic motif;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	157	182	Note=Basic motif;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Region	157	182	Note=Basic motif;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Region	183	211	Note=Leucine-zipper;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	183	211	Note=Leucine-zipper;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	183	211	Note=Leucine-zipper;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=150;End=185
P53539	Region	183	211	Note=Leucine-zipper;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Region	183	211	Note=Leucine-zipper;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	Type=Deletion;Start=43;End=185
P53539	Region	222	276	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Region	222	276	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Region	222	276	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Region	222	276	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Compositional bias	10	38	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=1;End=49
P53539	Compositional bias	103	132	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	103	132	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	140	163	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	140	163	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	140	163	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	140	163	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	140	163	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	172	190	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	172	190	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	172	190	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=150;End=185
P53539	Compositional bias	172	190	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	172	190	Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=43;End=185
P53539	Compositional bias	253	269	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Compositional bias	253	269	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Compositional bias	253	269	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284
P53539	Compositional bias	253	269	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=238;End=284

Gene Isoform Structures and Expression Levels for FOSB

Gene structures of our canonical and alternative spliced genes of FOSB
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of P53539-1

3D view using mol* of P53539-10

3D view using mol* of P53539-2

3D view using mol* of P53539-3

3D view using mol* of P53539-4

3D view using mol* of P53539-5

3D view using mol* of P53539-6

3D view using mol* of P53539-7

3D view using mol* of P53539-8

3D view using mol* of P53539-9

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of P53539-1

pLDDT distribution across the protein length of P53539-10

pLDDT distribution across the protein length of P53539-2

pLDDT distribution across the protein length of P53539-3

pLDDT distribution across the protein length of P53539-4

pLDDT distribution across the protein length of P53539-5

pLDDT distribution across the protein length of P53539-6

pLDDT distribution across the protein length of P53539-7

pLDDT distribution across the protein length of P53539-8

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of P53539-1

Ramachandran plot of P53539-10

Ramachandran plot of P53539-2

Ramachandran plot of P53539-4

Ramachandran plot of P53539-7

Ramachandran plot of P53539-8

Ramachandran plot of P53539-9

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
P53539-1	0.576	29	0.478	51.45	0.71	0.569	0.793	0.31	1.133	0.274	0.496	142,143,144,145,146,147,150,155,158,159,162
P53539-10	0.611	21	0.596	41.16	0.696	0.563	0.864	1.133	0.529	2.141	0.917	166,169,170,173,177
P53539-2	0.487	14	0.418	31.213	0.767	0.55	0.776	0.413	0.808	0.511	0.948	179,182,183,186,190
P53539-3	0.599	13	0.592	34.3	0.683	0.589	0.923	2.123	0.309	6.881	0.488	176,179,180,183,185,186,187
P53539-4	0.625	31	0.581	67.571	0.603	0.58	0.827	0.619	0.891	0.694	0.753	147,150,155,156,158,159,162,163
P53539-5	0.497	15	0.359	41.16	0.659	0.618	0.977	0.385	1.153	0.334	0.398	140,143,144,147,151
P53539-6	0.416	7	0.33	27.097	0.885	0.553	0.777	0.172	0.769	0.224	1.556	183,186,190
P53539-7	0.574	18	0.579	42.189	0.775	0.497	0.7	1.179	0.363	3.251	3.479	176,179,180,183,185,187
P53539-8	0.646	23	0.658	74.088	0.701	0.547	0.755	1.142	0.371	3.079	1.4	72,73,75,76,79,83

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of P53539-1_P53539-1_6uci_D.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of P53539-1_6uci_D_P53539-10.pdb

3D view using mol* of P53539-1_6uci_D_P53539-2.pdb

3D view using mol* of P53539-1_6uci_D_P53539-3.pdb

3D view using mol* of P53539-1_6uci_D_P53539-4.pdb

3D view using mol* of P53539-1_6uci_D_P53539-5.pdb

3D view using mol* of P53539-1_6uci_D_P53539-6.pdb

3D view using mol* of P53539-1_6uci_D_P53539-7.pdb

3D view using mol* of P53539-1_6uci_D_P53539-8.pdb

3D view using mol* of P53539-1_6uci_D_P53539-9.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of P53539-1_P53539-10.pdb

3D view using mol* of P53539-1_P53539-2.pdb

3D view using mol* of P53539-1_P53539-3.pdb

3D view using mol* of P53539-1_P53539-4.pdb

3D view using mol* of P53539-1_P53539-5.pdb

3D view using mol* of P53539-1_P53539-6.pdb

3D view using mol* of P53539-1_P53539-7.pdb

3D view using mol* of P53539-1_P53539-8.pdb

3D view using mol* of P53539-1_P53539-9.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/P53539-1_vs_P53539-10.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-2.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-3.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-4.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-5.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-6.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-7.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-8.png

./stats/secondary_structure/figure/P53539-1_vs_P53539-9.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/P53539-1_vs_P53539-10.png

./stats/relative_asa/P53539-1_vs_P53539-2.png

./stats/relative_asa/P53539-1_vs_P53539-3.png

./stats/relative_asa/P53539-1_vs_P53539-4.png

./stats/relative_asa/P53539-1_vs_P53539-5.png

./stats/relative_asa/P53539-1_vs_P53539-6.png

./stats/relative_asa/P53539-1_vs_P53539-7.png

./stats/relative_asa/P53539-1_vs_P53539-8.png

./stats/relative_asa/P53539-1_vs_P53539-9.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id

Subsection

Start

End

Funcitonal feature

Splicing information

Interactors from STRING.

Gene name

Interactors

Related Drugs to FOSB

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession

Gene name

DrugBank ID

Drug name

Drug group

Actions

Related Diseases to FOSB

Previous studies relating to the alternative splicing of FOSB and disease information from the MeSH term (PubMed)

Gene

PMID

Title

Abstract

MeSH ID

MeSH term

Clinically important variants in FOSB

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance