ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:EPGN

Protein Summary

Gene summary

Gene name: EPGN
ASpdb.0 ID: 255324
	Gene
Gene symbol	EPGN
Gene ID	255324
Gene name	epithelial mitogen
Synonyms	ALGV3072\|EPG\|PRO9904
Cytomap	4q13.3
Type of gene	protein-coding
Description	epigenepithelial mitogen homolog
Modification date	20240403
UniProtAcc	Q6UW88

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	EPGN	GO:0001525	angiogenesis	15611079
Gene	EPGN	GO:0005154	epidermal growth factor receptor binding	15611079
Gene	EPGN	GO:0005886	plasma membrane	15611079
Gene	EPGN	GO:0008083	growth factor activity	15611079
Gene	EPGN	GO:0008284	positive regulation of cell population proliferation	15611079
Gene	EPGN	GO:0043406	positive regulation of MAP kinase activity	15611079
Gene	EPGN	GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	15611079
Gene	EPGN	GO:0045840	positive regulation of mitotic nuclear division	15611079

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
Q6UW88-1	Q6UW88-1_5wb8_B.pdb	5WB8	X-ray	3.0	B	60	101

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
Q6UW88	EPGN	Q6UW88-1	Q6UW88-2	154	133	36	44	Deletion	none	none	35	35
Q6UW88	EPGN	Q6UW88-1	Q6UW88-2	154	133	137	154	Substitution	CLKLKSPYNVCSGERRPL	YEKDKI	128	133
Q6UW88	EPGN	Q6UW88-1	Q6UW88-3	154	112	96	137	Deletion	none	none	95	95
Q6UW88	EPGN	Q6UW88-1	Q6UW88-4	154	103	87	137	Deletion	none	none	86	86
Q6UW88	EPGN	Q6UW88-1	Q6UW88-5	154	103	36	44	Deletion	none	none	35	35
Q6UW88	EPGN	Q6UW88-1	Q6UW88-5	154	103	96	137	Deletion	none	none	86	86
Q6UW88	EPGN	Q6UW88-1	Q6UW88-6	154	94	36	44	Deletion	none	none	35	35
Q6UW88	EPGN	Q6UW88-1	Q6UW88-6	154	94	87	137	Deletion	none	none	77	77
Q6UW88	EPGN	Q6UW88-1	Q6UW88-7	154	73	15	44	Deletion	none	none	14	14
Q6UW88	EPGN	Q6UW88-1	Q6UW88-7	154	73	87	137	Deletion	none	none	56	56

Multiple sequence alignment of our canonical and alternatively spliced EPGN

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of EPGN

UniProt-id	ENSG	ENST	ENSP
Q6UW88-1	ENSG00000182585.10	ENST00000413830.6	ENSP00000411898.1
Q6UW88-2	ENSG00000182585.10	ENST00000332112.8	ENSP00000330375.4
Q6UW88-3	ENSG00000182585.10	ENST00000503098.5	ENSP00000425890.1
Q6UW88-4	ENSG00000182585.10	ENST00000502358.5	ENSP00000426678.1
Q6UW88-5	ENSG00000182585.10	ENST00000514968.5	ENSP00000426550.1
Q6UW88-6	ENSG00000182585.10	ENST00000505212.5	ENSP00000424392.1
Q6UW88-7	ENSG00000182585.10	ENST00000509145.5	ENSP00000426630.1

UniProt-id	NM ID	NP ID
Q6UW88-1	NM_001270989.1	NP_001257918.1
Q6UW88-3	NM_001270990.1	NP_001257919.1
Q6UW88-4	NM_001270992.1	NP_001257921.1
Q6UW88-5	NM_001270991.1	NP_001257920.1
Q6UW88-6	NM_001270993.1	NP_001257922.1

Amino acid sequences of our canonical and alternatively spliced EPGN

accession_id	Protein sequence
Q6UW88-1	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGY
Q6UW88-2	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLT
Q6UW88-3	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGY
Q6UW88-4	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCLKLK
Q6UW88-5	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCLKLK
Q6UW88-6	MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCLKLKSPYNVCSGE
Q6UW88-7

Protein Functional Features

Main function of this protein. (from UniProt)

EPGN (go to UniProt):Q6UW88

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=36;End=44
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=36;End=44
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=36;End=44
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=15;End=44
Q6UW88	Topological domain	23	110	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Transmembrane	111	131	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Transmembrane	111	131	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Transmembrane	111	131	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Transmembrane	111	131	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Transmembrane	111	131	Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=137;End=154
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=96;End=137
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Topological domain	132	154	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=87;End=137
Q6UW88	Domain	56	96	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076	Type=Deletion;Start=96;End=137
Q6UW88	Domain	56	96	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076	Type=Deletion;Start=87;End=137
Q6UW88	Domain	56	96	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076	Type=Deletion;Start=96;End=137
Q6UW88	Domain	56	96	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076	Type=Deletion;Start=87;End=137
Q6UW88	Domain	56	96	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076	Type=Deletion;Start=87;End=137

Gene Isoform Structures and Expression Levels for EPGN

Gene structures of our canonical and alternative spliced genes of EPGN
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of Q6UW88-1

3D view using mol* of Q6UW88-2

3D view using mol* of Q6UW88-3

3D view using mol* of Q6UW88-4

3D view using mol* of Q6UW88-5

3D view using mol* of Q6UW88-6

3D view using mol* of Q6UW88-7

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of Q6UW88-1

pLDDT distribution across the protein length of Q6UW88-2

pLDDT distribution across the protein length of Q6UW88-3

pLDDT distribution across the protein length of Q6UW88-4

pLDDT distribution across the protein length of Q6UW88-5

pLDDT distribution across the protein length of Q6UW88-6

pLDDT distribution across the protein length of Q6UW88-7

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of Q6UW88-1

Ramachandran plot of Q6UW88-4

Ramachandran plot of Q6UW88-6

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
Q6UW88-1	0.927	61	1.015	190.708	0.687	0.598	0.782	2.02	0.239	8.452	0.637	2,5,6,9,10,13,125,126,128,129,132,135,136,139
Q6UW88-2	0.843	45	0.912	124.166	0.708	0.59	0.775	2.017	0.223	9.035	11.493	6,9,10,12,13,111,112,114,115,118,119,122
Q6UW88-3	0.561	26	0.454	48.363	0.675	0.579	0.796	0.246	1.142	0.216	0.328	52,53,54,55,56,57,75,76,77,78
Q6UW88-4	0.674	33	0.64	56.595	0.577	0.614	0.805	1.277	0.823	1.552	0.178	52,54,55,56,57,58,75,76,77,78
Q6UW88-5	0.678	29	0.652	63.798	0.633	0.627	0.778	0.9	0.707	1.272	0.59	45,46,47,48,49,66,67,68,69
Q6UW88-6	0.538	19	0.493	41.503	0.747	0.538	0.68	0.595	0.734	0.81	0.275	45,46,47,48,67,68,69
Q6UW88-7	0.833	77	0.774	137.886	0.597	0.583	0.853	0.301	1.228	0.245	1.1	12,13,15,16,17,18,19,20,21,22,23,24,25,26,27,28

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of Q6UW88-1_Q6UW88-1_5wb8_B.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-2.pdb

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-3.pdb

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-4.pdb

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-5.pdb

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-6.pdb

3D view using mol* of Q6UW88-1_5wb8_B_Q6UW88-7.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q6UW88-1_Q6UW88-2.pdb

3D view using mol* of Q6UW88-1_Q6UW88-3.pdb

3D view using mol* of Q6UW88-1_Q6UW88-4.pdb

3D view using mol* of Q6UW88-1_Q6UW88-5.pdb

3D view using mol* of Q6UW88-1_Q6UW88-6.pdb

3D view using mol* of Q6UW88-1_Q6UW88-7.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/Q6UW88-1_vs_Q6UW88-2.png