Protein:NCR3 |
Protein Summary |
 Gene summary |
| Gene name: NCR3 | ASpdb.0 ID: 259197 | Gene | Gene symbol | NCR3 | Gene ID | 259197 |
| Gene name | natural cytotoxicity triggering receptor 3 |
| Synonyms | 1C7|CD337|LY117|MALS|NKp30 |
| Cytomap | 6p21.33 |
| Type of gene | protein-coding |
| Description | natural cytotoxicity triggering receptor 3NK-p30activating NK-A1 receptoractivating natural killer receptor p30lymphocyte antigen 117natural killer cell p30-related protein |
| Modification date | 20240403 |
| UniProtAcc | O14931 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | NCR3 | GO:0002429 | immune response-activating cell surface receptor signaling pathway | 18852879 |
| Gene | NCR3 | GO:0030101 | natural killer cell activation | 18852879 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| O14931-1 | O14931-1_3noi_A.pdb | 3NOI | X-ray | 1.84 | A | 18 | 130 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| O14931 | NCR3 | O14931-1 | O14931-2 | 201 | 190 | 167 | 201 | Substitution | LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG | HCHMGTHCHSSDGPRGVIPEPRCP | 167 | 190 |
| O14931 | NCR3 | O14931-1 | O14931-3 | 201 | 177 | 166 | 201 | Substitution | CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG | YAKSTLSGFPQL | 166 | 177 |
| O14931 | NCR3 | O14931-1 | O14931-4 | 201 | 176 | 66 | 90 | Deletion | none | none | 65 | 65 |
| O14931 | NCR3 | O14931-1 | O14931-5 | 201 | 165 | 66 | 90 | Deletion | none | none | 65 | 65 |
| O14931 | NCR3 | O14931-1 | O14931-5 | 201 | 165 | 167 | 201 | Substitution | LTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG | HCHMGTHCHSSDGPRGVIPEPRCP | 142 | 165 |
| O14931 | NCR3 | O14931-1 | O14931-6 | 201 | 152 | 66 | 90 | Deletion | none | none | 65 | 65 |
| O14931 | NCR3 | O14931-1 | O14931-6 | 201 | 152 | 166 | 201 | Substitution | CLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG | YAKSTLSGFPQL | 141 | 152 |
| Multiple sequence alignment of our canonical and alternatively spliced NCR3 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of NCR3 |
| UniProt-id | ENSG | ENST | ENSP |
| O14931-1 | ENSG00000204475.10 | ENST00000340027.10 | ENSP00000342156.5 |
| O14931-1 | ENSG00000206430.8 | ENST00000383477.8 | ENSP00000372969.4 |
| O14931-1 | ENSG00000237103.6 | ENST00000415123.6 | ENSP00000416944.2 |
| O14931-1 | ENSG00000236315.6 | ENST00000420556.6 | ENSP00000405306.2 |
| O14931-1 | ENSG00000236979.6 | ENST00000430599.6 | ENSP00000416035.2 |
| O14931-1 | ENSG00000225211.6 | ENST00000435674.6 | ENSP00000390131.2 |
| O14931-1 | ENSG00000223833.6 | ENST00000437517.6 | ENSP00000398313.2 |
| O14931-1 | ENSG00000237808.6 | ENST00000447248.6 | ENSP00000389071.2 |
| O14931-2 | ENSG00000204475.10 | ENST00000376072.7 | ENSP00000365240.3 |
| O14931-2 | ENSG00000206430.8 | ENST00000383476.6 | ENSP00000372968.2 |
| O14931-2 | ENSG00000225211.6 | ENST00000412603.5 | ENSP00000389419.1 |
| O14931-2 | ENSG00000237808.6 | ENST00000418936.6 | ENSP00000402904.2 |
| O14931-2 | ENSG00000237103.6 | ENST00000436623.5 | ENSP00000404747.1 |
| O14931-2 | ENSG00000236979.6 | ENST00000441372.5 | ENSP00000399128.1 |
| O14931-2 | ENSG00000223833.6 | ENST00000452296.6 | ENSP00000403978.2 |
| O14931-2 | ENSG00000236315.6 | ENST00000457547.5 | ENSP00000412702.1 |
| O14931-3 | ENSG00000204475.10 | ENST00000376073.8 | ENSP00000365241.4 |
| O14931-3 | ENSG00000206430.8 | ENST00000383478.8 | ENSP00000372970.4 |
| O14931-3 | ENSG00000236315.6 | ENST00000432392.6 | ENSP00000409874.2 |
| O14931-3 | ENSG00000237808.6 | ENST00000433654.6 | ENSP00000391177.2 |
| O14931-3 | ENSG00000223833.6 | ENST00000436253.6 | ENSP00000395238.2 |
| O14931-3 | ENSG00000237103.6 | ENST00000439584.6 | ENSP00000408960.2 |
| O14931-3 | ENSG00000236979.6 | ENST00000446756.6 | ENSP00000411205.2 |
| O14931-3 | ENSG00000225211.6 | ENST00000455825.6 | ENSP00000389396.2 |
| O14931-5 | ENSG00000204475.10 | ENST00000376071.4 | ENSP00000365239.4 |
| O14931-5 | ENSG00000206430.8 | ENST00000400241.7 | ENSP00000383100.3 |
| O14931-5 | ENSG00000223833.6 | ENST00000419086.6 | ENSP00000416105.2 |
| O14931-5 | ENSG00000236315.6 | ENST00000419728.6 | ENSP00000406373.2 |
| O14931-5 | ENSG00000237808.6 | ENST00000420485.6 | ENSP00000412474.2 |
| O14931-5 | ENSG00000225211.6 | ENST00000438663.6 | ENSP00000415697.2 |
| O14931-5 | ENSG00000236979.6 | ENST00000453657.6 | ENSP00000409048.2 |
| O14931-5 | ENSG00000237103.6 | ENST00000455448.6 | ENSP00000415456.2 |
| UniProt-id | NM ID | NP ID |
| O14931-1 | NM_147130.2 | NP_667341.1 |
| O14931-1 | XM_006715049.3 | XP_006715112.1 |
| O14931-2 | NM_001145467.1 | NP_001138939.1 |
| O14931-3 | NM_001145466.1 | NP_001138938.1 |
| O14931-4 | XM_011514459.2 | XP_011512761.1 |
| Amino acid sequences of our canonical and alternatively spliced NCR3 |
| accession_id | Protein sequence |
| O14931-1 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQ AELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV |
| O14931-2 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQ AELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCHCHMGTHCHSSDGP |
| O14931-3 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQ |
| O14931-4 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEAELHIRDVRGHDASIYVCRVEVLGL |
| O14931-5 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEAELHIRDVRGHDASIYVCRVEVLGL |
| O14931-6 | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEAELHIRDVRGHDASIYVCRVEVLGL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| NCR3 (go to UniProt):O14931 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| O14931 | Topological domain | 19 | 135 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=66;End=90 |
| O14931 | Topological domain | 19 | 135 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=66;End=90 |
| O14931 | Topological domain | 19 | 135 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=66;End=90 |
| O14931 | Topological domain | 157 | 201 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=167;End=201 |
| O14931 | Topological domain | 157 | 201 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=166;End=201 |
| O14931 | Topological domain | 157 | 201 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=167;End=201 |
| O14931 | Topological domain | 157 | 201 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=166;End=201 |
| O14931 | Domain | 19 | 126 | Note=Ig-like | Type=Deletion;Start=66;End=90 |
| O14931 | Domain | 19 | 126 | Note=Ig-like | Type=Deletion;Start=66;End=90 |
| O14931 | Domain | 19 | 126 | Note=Ig-like | Type=Deletion;Start=66;End=90 |
Gene Isoform Structures and Expression Levels for NCR3 |
| Gene structures of our canonical and alternative spliced genes of NCR3 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of O14931-1 |
| 3D view using mol* of O14931-2 |
| 3D view using mol* of O14931-3 |
| 3D view using mol* of O14931-4 |
| 3D view using mol* of O14931-5 |
| 3D view using mol* of O14931-6 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of O14931-1 |
 |
| pLDDT distribution across the protein length of O14931-2 |
 |
| pLDDT distribution across the protein length of O14931-3 |
 |
| pLDDT distribution across the protein length of O14931-4 |
 |
| pLDDT distribution across the protein length of O14931-5 |
 |
| pLDDT distribution across the protein length of O14931-6 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of O14931-1 |
 |
| Ramachandran plot of O14931-2 |
 |
| Ramachandran plot of O14931-3 |
 |
| Ramachandran plot of O14931-4 |
 |
| Ramachandran plot of O14931-6 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| O14931-1 | 0.855 | 66 | 0.876 | 188.307 | 0.709 | 0.611 | 0.759 | 0.571 | 0.78 | 0.732 | 0.71 | 52,53,54,55,65,66,67,68,77,78,79,80,81,84,85,92,93 ,94 |
| O14931-2 | 0.832 | 60 | 0.846 | 179.732 | 0.704 | 0.618 | 0.756 | 0.597 | 0.776 | 0.77 | 0.613 | 36,53,54,55,66,67,68,77,78,79,80,81,84,92,93,94
|
| O14931-3 | 0.785 | 52 | 0.786 | 183.505 | 0.756 | 0.611 | 0.766 | 0.561 | 0.793 | 0.708 | 0.697 | 52,53,54,55,65,66,67,68,77,78,79,80,82,85,92,93,94 |
| O14931-4 | 0.664 | 29 | 0.637 | 84.721 | 0.782 | 0.61 | 0.861 | 0.874 | 0.721 | 1.213 | 2.04 | 40,41,43,45,48,49,51,52,53,85,87
|
| O14931-5 | 0.638 | 24 | 0.609 | 63.455 | 0.727 | 0.605 | 0.841 | 0.735 | 0.657 | 1.118 | 3.367 | 140,141,144,161,162,164
|
| O14931-6 | 0.527 | 14 | 0.431 | 48.706 | 0.689 | 0.654 | 0.992 | 0.675 | 0.961 | 0.702 | 0.878 | 43,44,47,48,49,50,87,88,90
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of O14931-1_O14931-1_3noi_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O14931-1_3noi_A_O14931-2.pdb |
| 3D view using mol* of O14931-1_3noi_A_O14931-3.pdb |
| 3D view using mol* of O14931-1_3noi_A_O14931-4.pdb |
| 3D view using mol* of O14931-1_3noi_A_O14931-5.pdb |
| 3D view using mol* of O14931-1_3noi_A_O14931-6.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O14931-1_O14931-2.pdb |
| 3D view using mol* of O14931-1_O14931-3.pdb |
| 3D view using mol* of O14931-1_O14931-4.pdb |
| 3D view using mol* of O14931-1_O14931-5.pdb |
| 3D view using mol* of O14931-1_O14931-6.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/O14931-1_vs_O14931-2.png |
 < |
| ./stats/secondary_structure/figure/O14931-1_vs_O14931-3.png |
 < |
| ./stats/secondary_structure/figure/O14931-1_vs_O14931-4.png |
 < |
| ./stats/secondary_structure/figure/O14931-1_vs_O14931-5.png |
 < |
| ./stats/secondary_structure/figure/O14931-1_vs_O14931-6.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/O14931-1_vs_O14931-2.png |
 < |
| ./stats/relative_asa/O14931-1_vs_O14931-3.png |
 < |
| ./stats/relative_asa/O14931-1_vs_O14931-4.png |
 < |
| ./stats/relative_asa/O14931-1_vs_O14931-5.png |
 < |
| ./stats/relative_asa/O14931-1_vs_O14931-6.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to NCR3 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to NCR3 |
| Previous studies relating to the alternative splicing of NCR3 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| NCR3 | 16362817 | LST1 and NCR3 expression in autoimmune inflammation and in response to IFN-gamma, LPS and microbial infection. | Many genes in the central region of the major histocompatibility complex (MHC) encode proteins involved in immune and inflammatory responses. In this study, we have further characterized two genes in the MHC class IV region, leucocyte-specific transcript (LST) 1 and natural cytotoxicity-triggering receptor 3 (NCR3) (also known as 1C7 and natural killer (NK)p30). The specific function of LST1 is not known, although expression analysis and functional data suggest an immunomodulatory role. The LST1 gene undergoes extensive alternative splicing, giving rise to both membrane-bound (encoded by exon 3) and soluble isoforms. The NCR3 protein is involved in NK-mediated cytotoxicity and plays a role in NK/dendritic cell crosstalk. Expression of these genes was examined, by real-time reverse transcriptase-polymerase chain reaction, in autoimmune-induced inflammation, specifically rheumatoid-arthritis-affected blood and synovium, and in response to stimulation with inflammatory mediators and bacterial agents. The expression of LST1, specifically splice variants encoding soluble isoforms and NCR3, was increased in rheumatoid-arthritis-affected blood and synovium and was associated with more severe inflammation in the synovium. Furthermore, both genes were significantly up-regulated in response to lipopolysaccharide, interferon (IFN)-gamma and bacterial infection. These findings suggest that NCR3 and soluble isoforms of LST1 may play a role in inflammatory and infectious diseases. | D001172 | Arthritis, Rheumatoid |
Clinically important variants in NCR3 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |