ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures
ASpdb Logo

Home

Download

Statistics

Examples

Help

Contact

Terms of Use

Center for Computational Systems Medicine
leaf

Protein Summary

leaf

AS Summary

leaf

Protein Functional Features

leaf

Gene Isoform Structures and Expression Levels

leaf

Protein Structures

leaf

pLDDT Score Distribution

leaf

Ramachandran Plot of Protein Structures

leaf

Potential Active Site Information

leaf

Protein Structure and Feature Comparision

leaf

Protein-Protein Interaction

leaf

Related Drugs

leaf

Related Diseases

leaf

Clinically Important Variants

Protein:GATA1

Protein Summary

check button Gene summary
Gene name: GATA1
ASpdb.0 ID: 2623
Gene
Gene symbol

GATA1

Gene ID

2623

Gene nameGATA binding protein 1
SynonymsERYF1|GATA-1|GF-1|GF1|HAEADA|NF-E1|NFE1|XLANP|XLTDA|XLTT
Cytomap

Xp11.23

Type of geneprotein-coding
Descriptionerythroid transcription factorGATA-binding factor 1NF-E1 DNA-binding proteinerythroid transcription factor 1globin transcription factor 1nuclear factor, erythroid 1transcription factor GATA1
Modification date20240411
UniProtAcc

P15976


check button Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
GeneGATA1

GO:0000122

negative regulation of transcription by RNA polymerase II

22235304

GeneGATA1

GO:0000977

RNA polymerase II transcription regulatory region sequence-specific DNA binding

2467208

GeneGATA1

GO:0000978

RNA polymerase II cis-regulatory region sequence-specific DNA binding

15920471|24245781

GeneGATA1

GO:0001228

DNA-binding transcription activator activity, RNA polymerase II-specific

15920471

GeneGATA1

GO:0003677

DNA binding

8628290|11418466|12609092|22235304

GeneGATA1

GO:0003700

DNA-binding transcription factor activity

2467208

GeneGATA1

GO:0005634

nucleus

2467208|10700180|17167422

GeneGATA1

GO:0005654

nucleoplasm

-

GeneGATA1

GO:0005667

transcription regulator complex

15920471

GeneGATA1

GO:0010724

regulation of definitive erythrocyte differentiation

12200364|15920471

GeneGATA1

GO:0017053

transcription repressor complex

15920471

GeneGATA1

GO:0031490

chromatin DNA binding

22235304

GeneGATA1

GO:0032993

protein-DNA complex

12609092

GeneGATA1

GO:0035854

eosinophil fate commitment

12045236

GeneGATA1

GO:0045893

positive regulation of DNA-templated transcription

24245781

GeneGATA1

GO:0045944

positive regulation of transcription by RNA polymerase II

2467208|12200364|15920471

GeneGATA1

GO:1990837

sequence-specific double-stranded DNA binding

28473536

GeneGATA1

GO:2000678

negative regulation of transcription regulatory region DNA binding

15920471



AS Summary

check button Information of the canonical protein with experimentally identified structure from PDB (2023).
UniProt AccFile namePDB IDMethodResolutionChainStartEnd
P15976-1P15976-1_6g0q_B.pdb6G0QX-ray1.4B310319

check button ASpdb's canonical and alternatively spliced isoform information.
accession_idgene_namecanonical_idalternative_idcanonical_lengthalternative_lengthcanonical_startcanonical_endtypeoriginalSEQvariationSEQalternative_startalternative_end
P15976GATA1P15976-1P15976-2413335290413SubstitutionQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSSHQHYCGGSAQLMRAQSMASRGGVVSFSSCSQNSGQPKSLGPRHPLA290335
P15976GATA1P15976-1P15976-3413330183Deletionnonenone00

check buttonMultiple sequence alignment of our canonical and alternatively spliced GATA1

check button Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of GATA1
UniProt-idENSGENSTENSP
P15976-1ENSG00000102145.16ENST00000376670.9ENSP00000365858.3
P15976-3ENSG00000102145.16ENST00000651144.2ENSP00000498550.1

UniProt-idNM IDNP ID
P15976-1NM_002049.3NP_002040.1

check buttonAmino acid sequences of our canonical and alternatively spliced GATA1
accession_idProtein sequence
P15976-1MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGG
SPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWR
RNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT
P15976-2MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGG
SPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWR
P15976-3MEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFF
SPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQT
TTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGL

Protein Functional Features

check buttonMain function of this protein. (from UniProt)
GATA1 (go to UniProt):P15976

check buttonRetention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

* Minus value of BPloci means that the break pointn is located before the CDS.
- Retained protein feature among the 13 regional features.
Accession_idSubsectionStartEndFuncitonal featureSplicing information
P15976Region200330Note=Interaction with MED1 and CCAR1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24245781;Dbxref=PMID:24245781Type=Substitution;Start=290;End=413
P15976Region249315Note=Interaction with CALCOCO1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24245781;Dbxref=PMID:24245781Type=Substitution;Start=290;End=413
P15976Region297327Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-liteType=Substitution;Start=290;End=413


Gene Isoform Structures and Expression Levels for GATA1

check buttonGene structures of our canonical and alternative spliced genes of GATA1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
gene isoform structure of GATA1

check button Expression levels of gene isoforms across GTEx.
gtex expression

check button Expression levels of gene isoforms across TCGA.
tcga expression


Protein Structures

check button PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.
3D view using mol* of P15976-1
3D view using mol* of P15976-2
3D view using mol* of P15976-3


pLDDT Score Distribution

check button pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.
pLDDT distribution across the protein length of P15976-1
all structure
pLDDT distribution across the protein length of P15976-2
all structure
pLDDT distribution across the protein length of P15976-3
all structure


Ramachandran Plot of Protein Structures


check button Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.
Ramachandran plot of P15976-1
all structure
Ramachandran plot of P15976-2
all structure
Ramachandran plot of P15976-3
all structure

Potential Active Site Information


check button The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.
UniProt-idSite scoreSizeD scoreVolumeExposureEnclosureContactPhobicPhilicBalanceDon/AccResidues
P15976-10.9834050.965845.4950.4870.6730.9010.3041.1630.2620.65569,203,205,206,208,216,217,218,219,220,222,224,229
,232,233,236,237,238,239,240,241,244,245,246,247,2
48,249,250,260,261,263,265,266,267,279,280,281,282
,293,297,298,299,300,301,302,303,304,305,306,307,3
08,309,310,311,312,313,314
P15976-20.9962091.028720.6430.5780.670.9110.5870.9630.610.515241,244,245,247,248,249,250,261,263,265,266,267,27
9,280,281,282,284,285,288,291,292,293,294,297,300,
301,302,304,305,306,307,308,309,310,311,313,314,31
5,316,317,318,320
P15976-30.9922550.96579.670.4640.6860.9390.2941.20.2450.507122,123,139,154,155,156,157,158,161,162,163,164,16
5,166,167,178,180,182,183,184,196,197,198,210,215,
216,217,218,219,220,221,222,223,224,225,226,227

Protein Structure and Feature Comparision


check button Protein Structure Comparision Using Template Modeling Scores (TM-score).
all structure

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)
3D view using mol* of P15976-1_P15976-1_6g0q_B.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of P15976-1_6g0q_B_P15976-2.pdb
3D view using mol* of P15976-1_6g0q_B_P15976-3.pdb

check button Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)
3D view using mol* of P15976-1_P15976-2.pdb
3D view using mol* of P15976-1_P15976-3.pdb

check button Protein Feature Comparison of the protein sequendary structures among the protiens.
./stats/secondary_structure/figure/P15976-1_vs_P15976-2.png
all structure<
./stats/secondary_structure/figure/P15976-1_vs_P15976-3.png
all structure<

check button Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.
./stats/relative_asa/P15976-1_vs_P15976-2.png
all structure<
./stats/relative_asa/P15976-1_vs_P15976-3.png
all structure<


Protein-Protein Interaction


check button Interactors from UniProt.
Accession_idSubsectionStartEndFuncitonal featureSplicing information
P15976Region200330Note=Interaction with MED1 and CCAR1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24245781;Dbxref=PMID:24245781Type=Substitution;Start=290;End=413
P15976Region249315Note=Interaction with CALCOCO1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:24245781;Dbxref=PMID:24245781Type=Substitution;Start=290;End=413


check button Interactors from STRING.
Gene nameInteractors


Related Drugs to GATA1


check button Drugs targeting this gene/protein.
(DrugBank)
UniProt accessionGene nameDrugBank IDDrug nameDrug groupActions

Related Diseases to GATA1


check button Previous studies relating to the alternative splicing of GATA1 and disease information from the MeSH term (PubMed)
GenePMIDTitleAbstractMeSH IDMeSH term
GATA112649131Mutations in exon 2 of GATA1 are early events in megakaryocytic malignancies associated with trisomy 21.Patients with Down syndrome (DS) frequently develop 2 kinds of clonal megakaryocytosis: a common, congenital, spontaneously resolving, transient myeloproliferative disorder (TMD) and, less commonly, childhood acute megakaryoblastic leukemia (AMKL). Recently, acquired mutations in exon 2 of GATA1, an X-linked gene encoding a transcription factor that promotes megakaryocytic differentiation, were described in 6 DS patients with AMKL. The mutations prevent the synthesis of the full-length GATA1, but allow the synthesis of a shorter GATA1 protein (GATA1s) that lacks the transactivation domain. To test whether mutated GATA1 is involved in the initiation of clonal megakaryoblastic proliferation or in the progression to AMKL, we screened 35 DS patients with either AMKL or TMD and 7 non-DS children with AMKL for mutations in exon 2 of GATA1. Mutations were identified in 16 of 18 DS patients with AMKL, in 16 of 17 DS patients with TMD, and in 2 identical twins with AMKL and acquired trisomy 21. Analysis revealed various types of mutations in GATA1, including deletion/insertions, splice mutations, and nonsense and missense point mutations, all of which prevent the generation of full-length GATA1, but preserve the translation of GATA1s. We also show that the likely mechanism of generation of GATA1 isoforms is alternative splicing of exon 2 rather than, or in addition to, alternative translation initiation, as was proposed before. These findings suggest that acquired intrauterine inactivating mutations in GATA1 and generation of GATA1s cooperate frequently with trisomy 21 in initiating megakaryoblastic proliferation, but are insufficient for progression to AMKL.D002471Cell Transformation, Neoplastic
GATA112649131Mutations in exon 2 of GATA1 are early events in megakaryocytic malignancies associated with trisomy 21.Patients with Down syndrome (DS) frequently develop 2 kinds of clonal megakaryocytosis: a common, congenital, spontaneously resolving, transient myeloproliferative disorder (TMD) and, less commonly, childhood acute megakaryoblastic leukemia (AMKL). Recently, acquired mutations in exon 2 of GATA1, an X-linked gene encoding a transcription factor that promotes megakaryocytic differentiation, were described in 6 DS patients with AMKL. The mutations prevent the synthesis of the full-length GATA1, but allow the synthesis of a shorter GATA1 protein (GATA1s) that lacks the transactivation domain. To test whether mutated GATA1 is involved in the initiation of clonal megakaryoblastic proliferation or in the progression to AMKL, we screened 35 DS patients with either AMKL or TMD and 7 non-DS children with AMKL for mutations in exon 2 of GATA1. Mutations were identified in 16 of 18 DS patients with AMKL, in 16 of 17 DS patients with TMD, and in 2 identical twins with AMKL and acquired trisomy 21. Analysis revealed various types of mutations in GATA1, including deletion/insertions, splice mutations, and nonsense and missense point mutations, all of which prevent the generation of full-length GATA1, but preserve the translation of GATA1s. We also show that the likely mechanism of generation of GATA1 isoforms is alternative splicing of exon 2 rather than, or in addition to, alternative translation initiation, as was proposed before. These findings suggest that acquired intrauterine inactivating mutations in GATA1 and generation of GATA1s cooperate frequently with trisomy 21 in initiating megakaryoblastic proliferation, but are insufficient for progression to AMKL.D004314Down Syndrome
GATA112649131Mutations in exon 2 of GATA1 are early events in megakaryocytic malignancies associated with trisomy 21.Patients with Down syndrome (DS) frequently develop 2 kinds of clonal megakaryocytosis: a common, congenital, spontaneously resolving, transient myeloproliferative disorder (TMD) and, less commonly, childhood acute megakaryoblastic leukemia (AMKL). Recently, acquired mutations in exon 2 of GATA1, an X-linked gene encoding a transcription factor that promotes megakaryocytic differentiation, were described in 6 DS patients with AMKL. The mutations prevent the synthesis of the full-length GATA1, but allow the synthesis of a shorter GATA1 protein (GATA1s) that lacks the transactivation domain. To test whether mutated GATA1 is involved in the initiation of clonal megakaryoblastic proliferation or in the progression to AMKL, we screened 35 DS patients with either AMKL or TMD and 7 non-DS children with AMKL for mutations in exon 2 of GATA1. Mutations were identified in 16 of 18 DS patients with AMKL, in 16 of 17 DS patients with TMD, and in 2 identical twins with AMKL and acquired trisomy 21. Analysis revealed various types of mutations in GATA1, including deletion/insertions, splice mutations, and nonsense and missense point mutations, all of which prevent the generation of full-length GATA1, but preserve the translation of GATA1s. We also show that the likely mechanism of generation of GATA1 isoforms is alternative splicing of exon 2 rather than, or in addition to, alternative translation initiation, as was proposed before. These findings suggest that acquired intrauterine inactivating mutations in GATA1 and generation of GATA1s cooperate frequently with trisomy 21 in initiating megakaryoblastic proliferation, but are insufficient for progression to AMKL.D007947Leukemia, Megakaryoblastic, Acute
GATA112649131Mutations in exon 2 of GATA1 are early events in megakaryocytic malignancies associated with trisomy 21.Patients with Down syndrome (DS) frequently develop 2 kinds of clonal megakaryocytosis: a common, congenital, spontaneously resolving, transient myeloproliferative disorder (TMD) and, less commonly, childhood acute megakaryoblastic leukemia (AMKL). Recently, acquired mutations in exon 2 of GATA1, an X-linked gene encoding a transcription factor that promotes megakaryocytic differentiation, were described in 6 DS patients with AMKL. The mutations prevent the synthesis of the full-length GATA1, but allow the synthesis of a shorter GATA1 protein (GATA1s) that lacks the transactivation domain. To test whether mutated GATA1 is involved in the initiation of clonal megakaryoblastic proliferation or in the progression to AMKL, we screened 35 DS patients with either AMKL or TMD and 7 non-DS children with AMKL for mutations in exon 2 of GATA1. Mutations were identified in 16 of 18 DS patients with AMKL, in 16 of 17 DS patients with TMD, and in 2 identical twins with AMKL and acquired trisomy 21. Analysis revealed various types of mutations in GATA1, including deletion/insertions, splice mutations, and nonsense and missense point mutations, all of which prevent the generation of full-length GATA1, but preserve the translation of GATA1s. We also show that the likely mechanism of generation of GATA1 isoforms is alternative splicing of exon 2 rather than, or in addition to, alternative translation initiation, as was proposed before. These findings suggest that acquired intrauterine inactivating mutations in GATA1 and generation of GATA1s cooperate frequently with trisomy 21 in initiating megakaryoblastic proliferation, but are insufficient for progression to AMKL.D009196Myeloproliferative Disorders
GATA112649131Mutations in exon 2 of GATA1 are early events in megakaryocytic malignancies associated with trisomy 21.Patients with Down syndrome (DS) frequently develop 2 kinds of clonal megakaryocytosis: a common, congenital, spontaneously resolving, transient myeloproliferative disorder (TMD) and, less commonly, childhood acute megakaryoblastic leukemia (AMKL). Recently, acquired mutations in exon 2 of GATA1, an X-linked gene encoding a transcription factor that promotes megakaryocytic differentiation, were described in 6 DS patients with AMKL. The mutations prevent the synthesis of the full-length GATA1, but allow the synthesis of a shorter GATA1 protein (GATA1s) that lacks the transactivation domain. To test whether mutated GATA1 is involved in the initiation of clonal megakaryoblastic proliferation or in the progression to AMKL, we screened 35 DS patients with either AMKL or TMD and 7 non-DS children with AMKL for mutations in exon 2 of GATA1. Mutations were identified in 16 of 18 DS patients with AMKL, in 16 of 17 DS patients with TMD, and in 2 identical twins with AMKL and acquired trisomy 21. Analysis revealed various types of mutations in GATA1, including deletion/insertions, splice mutations, and nonsense and missense point mutations, all of which prevent the generation of full-length GATA1, but preserve the translation of GATA1s. We also show that the likely mechanism of generation of GATA1 isoforms is alternative splicing of exon 2 rather than, or in addition to, alternative translation initiation, as was proposed before. These findings suggest that acquired intrauterine inactivating mutations in GATA1 and generation of GATA1s cooperate frequently with trisomy 21 in initiating megakaryoblastic proliferation, but are insufficient for progression to AMKL.D014314Trisomy


Clinically important variants in GATA1


check button (ClinVar, 04/20/2024)
accession_iduniprot_idgene_nameTypeVariantClinical_significance