Protein:BIN1 |
Protein Summary |
Gene summary |
| Gene name: BIN1 | ASpdb.0 ID: 274 | Gene | Gene symbol | BIN1 | Gene ID | 274 |
| Gene name | bridging integrator 1 |
| Synonyms | AMPH2|AMPHL|CNM2|SH3P9 |
| Cytomap | 2q14.3 |
| Type of gene | protein-coding |
| Description | myc box-dependent-interacting protein 1amphiphysin 2amphiphysin IIamphiphysin-like proteinbox dependant MYC interacting protein 1box-dependent myc-interacting protein 1 |
| Modification date | 20240305 |
| UniProtAcc | O00499 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | BIN1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 10412034 |
| Gene | BIN1 | GO:0005634 | nucleus | 8782822|25051234 |
| Gene | BIN1 | GO:0005737 | cytoplasm | 25051234 |
| Gene | BIN1 | GO:0005829 | cytosol | - |
| Gene | BIN1 | GO:0005856 | cytoskeleton | 25051234 |
| Gene | BIN1 | GO:0010564 | regulation of cell cycle process | 8782822 |
| Gene | BIN1 | GO:0016020 | membrane | 16530520|25051234 |
| Gene | BIN1 | GO:0030424 | axon | 23399914 |
| Gene | BIN1 | GO:0033292 | T-tubule organization | 24755653 |
| Gene | BIN1 | GO:0043065 | positive regulation of apoptotic process | 16530520 |
| Gene | BIN1 | GO:0051015 | actin filament binding | 26506308 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| O00499-1 | O00499-1_2fic_B.pdb | 2FIC | X-ray | 1.99 | B | 40 | 271 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| O00499 | BIN1 | O00499-1 | O00499-10 | 593 | 424 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-10 | 593 | 424 | 285 | 285 | Substitution | P | PRKKSKLFSRLRRKKN | 254 | 269 |
| O00499 | BIN1 | O00499-1 | O00499-10 | 593 | 424 | 335 | 487 | Deletion | none | none | 318 | 318 |
| O00499 | BIN1 | O00499-1 | O00499-11 | 593 | 497 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-11 | 593 | 497 | 285 | 285 | Substitution | P | PRKKSKLFSRLRRKKN | 254 | 269 |
| O00499 | BIN1 | O00499-1 | O00499-11 | 593 | 497 | 378 | 457 | Deletion | none | none | 361 | 361 |
| O00499 | BIN1 | O00499-1 | O00499-2 | 593 | 518 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-2 | 593 | 518 | 378 | 421 | Deletion | none | none | 346 | 346 |
| O00499 | BIN1 | O00499-1 | O00499-3 | 593 | 506 | 335 | 421 | Deletion | none | none | 334 | 334 |
| O00499 | BIN1 | O00499-1 | O00499-4 | 593 | 475 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-4 | 593 | 475 | 335 | 421 | Deletion | none | none | 303 | 303 |
| O00499 | BIN1 | O00499-1 | O00499-5 | 593 | 550 | 335 | 377 | Deletion | none | none | 334 | 334 |
| O00499 | BIN1 | O00499-1 | O00499-6 | 593 | 482 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-6 | 593 | 482 | 378 | 457 | Deletion | none | none | 346 | 346 |
| O00499 | BIN1 | O00499-1 | O00499-7 | 593 | 439 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-7 | 593 | 439 | 335 | 457 | Deletion | none | none | 303 | 303 |
| O00499 | BIN1 | O00499-1 | O00499-8 | 593 | 454 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-8 | 593 | 454 | 285 | 285 | Substitution | P | PRKKSKLFSRLRRKKN | 254 | 269 |
| O00499 | BIN1 | O00499-1 | O00499-8 | 593 | 454 | 335 | 457 | Deletion | none | none | 318 | 318 |
| O00499 | BIN1 | O00499-1 | O00499-9 | 593 | 409 | 174 | 204 | Deletion | none | none | 173 | 173 |
| O00499 | BIN1 | O00499-1 | O00499-9 | 593 | 409 | 335 | 487 | Deletion | none | none | 303 | 303 |
Multiple sequence alignment of our canonical and alternatively spliced BIN1 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of BIN1 |
| UniProt-id | ENSG | ENST | ENSP |
| O00499-1 | ENSG00000136717.15 | ENST00000316724.10 | ENSP00000316779.5 |
| O00499-10 | ENSG00000136717.15 | ENST00000376113.6 | ENSP00000365281.2 |
| O00499-11 | ENSG00000136717.15 | ENST00000259238.8 | ENSP00000259238.4 |
| O00499-2 | ENSG00000136717.15 | ENST00000346226.7 | ENSP00000315411.3 |
| O00499-3 | ENSG00000136717.15 | ENST00000351659.7 | ENSP00000315388.3 |
| O00499-4 | ENSG00000136717.15 | ENST00000393041.7 | ENSP00000376761.3 |
| O00499-5 | ENSG00000136717.15 | ENST00000357970.7 | ENSP00000350654.3 |
| O00499-6 | ENSG00000136717.15 | ENST00000393040.7 | ENSP00000376760.3 |
| O00499-7 | ENSG00000136717.15 | ENST00000409400.1 | ENSP00000386797.1 |
| O00499-8 | ENSG00000136717.15 | ENST00000352848.8 | ENSP00000315284.4 |
| O00499-9 | ENSG00000136717.15 | ENST00000348750.8 | ENSP00000259237.5 |
| UniProt-id | NM ID | NP ID |
| O00499-1 | NM_139343.2 | NP_647593.1 |
| O00499-10 | NM_001320632.1 | NP_001307561.1 |
| O00499-11 | NM_139346.2 | NP_647596.1 |
| O00499-2 | NM_139347.2 | NP_647597.1 |
| O00499-3 | NM_139345.2 | NP_647595.1 |
| O00499-4 | NM_139349.2 | NP_647599.1 |
| O00499-5 | NM_139344.2 | NP_647594.1 |
| O00499-6 | NM_139348.2 | NP_647598.1 |
| O00499-7 | NM_139350.2 | NP_647600.1 |
| O00499-8 | NM_004305.3 | NP_004296.1 |
| O00499-9 | NM_139351.2 | NP_647601.1 |
Amino acid sequences of our canonical and alternatively spliced BIN1 |
| accession_id | Protein sequence |
| O00499-1 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGL EKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILS LFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQT AEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQ |
| O00499-10 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNS DNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQH |
| O00499-11 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNS DNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPS QPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDV |
| O00499-2 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPD GSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPTESPAGSLPSGEP SAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKV |
| O00499-3 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGL EKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPTESPAGSLPSGEPSAAEGTFAVSWP SQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTD |
| O00499-4 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPD GSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPG ETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKE |
| O00499-5 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGL EKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQFEAPGPFSEQASLLDLDFDPLPPVTS PVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAV VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGV |
| O00499-6 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPD GSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPA AGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEG |
| O00499-7 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPD GSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGR |
| O00499-8 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNS DNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFP ATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFT |
| O00499-9 | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVY EPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPD GSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAG |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| BIN1 (go to UniProt):O00499 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Domain | 29 | 276 | Note=BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00361 | Type=Deletion;Start=174;End=204 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=285;End=285 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=487 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=285;End=285 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=377 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=285;End=285 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 280 | 354 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=487 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=487 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=378;End=457 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=378;End=421 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=378;End=457 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 378 | 421 | Note=Clathrin-binding | Type=Deletion;Start=335;End=487 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=487 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=378;End=457 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=378;End=421 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=421 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=378;End=457 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=457 |
| O00499 | Region | 400 | 488 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=335;End=487 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
| O00499 | Coiled coil | 193 | 267 | Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=174;End=204 |
Gene Isoform Structures and Expression Levels for BIN1 |
Gene structures of our canonical and alternative spliced genes of BIN1* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of O00499-1 |
| 3D view using mol* of O00499-10 |
| 3D view using mol* of O00499-11 |
| 3D view using mol* of O00499-2 |
| 3D view using mol* of O00499-3 |
| 3D view using mol* of O00499-4 |
| 3D view using mol* of O00499-5 |
| 3D view using mol* of O00499-6 |
| 3D view using mol* of O00499-7 |
| 3D view using mol* of O00499-8 |
| 3D view using mol* of O00499-9 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of O00499-1 |
![]() |
| Ramachandran plot of O00499-3 |
![]() |
| Ramachandran plot of O00499-5 |
![]() |
| Ramachandran plot of O00499-6 |
![]() |
| Ramachandran plot of O00499-7 |
![]() |
| Ramachandran plot of O00499-8 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| O00499-1 | 1.002 | 77 | 1.056 | 220.549 | 0.469 | 0.707 | 1.002 | 1.852 | 0.591 | 3.133 | 3.61 | 160,163,164,167,168,171,172,175,179,191,194,195,19 7,198,201,202 |
| O00499-10 | 1.009 | 302 | 0.999 | 884.254 | 0.555 | 0.712 | 0.915 | 0.517 | 1.129 | 0.458 | 0.928 | 13,16,17,20,21,23,24,26,27,30,55,59,62,127,130,131 ,133,134,135,137,138,142,145,146,149,152,153,155,1 56,159,160,170,173,174,177,180,181,184,365,367,368 ,369,370,371,381,382,383,384,385,388,389,390,391,3 93,395,408,409,410,412,413,414 |
| O00499-11 | 1.008 | 458 | 1.02 | 1570.94 | 0.575 | 0.71 | 0.885 | 0.407 | 1.062 | 0.383 | 1.105 | 16,17,19,20,21,23,24,26,27,28,29,30,31,35,36,37,38 ,39,40,41,44,45,48,51,52,55,62,127,130,133,134,135 ,137,138,140,141,142,143,144,145,146,147,148,149,1 52,153,155,156,158,159,177,180,181,184,331,332,333 ,334,335,336,337,338,339,342,343,346,439,440,441,4 42,443,456,457,458,460,461,462,463,464,466,468,482 ,483,485,486,487 |
| O00499-2 | 1.027 | 357 | 1.013 | 1084.909 | 0.519 | 0.738 | 0.96 | 0.562 | 1.134 | 0.495 | 0.895 | 17,19,20,21,23,24,26,27,30,39,40,41,42,44,45,48,51 ,52,55,59,62,127,130,133,134,135,137,138,140,141,1 42,143,144,145,146,147,148,149,152,153,155,156,159 ,174,177,180,181,184,460,461,462,463,464,477,478,4 79,481,482,483,484,485,487,489,503,505,506,507,508 |
| O00499-3 | 0.999 | 330 | 1.009 | 1102.059 | 0.588 | 0.696 | 0.877 | 0.429 | 1.068 | 0.402 | 0.962 | 17,19,20,21,23,24,26,27,28,30,38,39,40,41,44,45,48 ,51,52,55,131,133,134,135,137,138,139,140,141,142, 143,144,145,146,147,148,149,152,153,155,156,159,20 8,211,212,215,216,447,448,449,450,451,452,453,465, 466,467,469,470,471,472,473,475,477,480,491,492,49 4,495,496 |
| O00499-4 | 1.008 | 371 | 1 | 1129.156 | 0.573 | 0.709 | 0.89 | 0.414 | 1.121 | 0.369 | 1.021 | 17,19,20,21,22,23,24,26,27,28,30,31,38,39,40,41,44 ,45,48,131,134,135,137,138,139,140,141,142,143,144 ,145,146,147,148,149,151,152,153,155,156,159,174,1 77,180,181,401,402,416,417,418,419,420,421,422,432 ,433,434,435,436,438,439,440,441,442,444,446,459,4 60,463,464,465 |
| O00499-5 | 1.011 | 247 | 1.032 | 953.197 | 0.595 | 0.71 | 0.911 | 0.476 | 1.026 | 0.464 | 0.908 | 13,14,16,17,19,20,21,23,24,26,27,134,135,137,138,1 39,141,142,145,146,149,152,153,155,156,205,208,211 ,212,215,492,493,494,495,496,497,509,510,511,514,5 15,516,517,519,521,535,536,538,539,540 |
| O00499-6 | 0.997 | 448 | 1.018 | 1570.254 | 0.61 | 0.689 | 0.836 | 0.375 | 1.028 | 0.364 | 1.276 | 17,20,21,23,24,26,27,28,30,31,32,34,35,36,37,38,39 ,40,41,44,45,48,51,52,55,62,130,131,133,134,135,13 7,138,139,140,141,142,143,144,145,146,147,148,149, 152,153,155,156,158,159,160,162,170,173,174,177,18 0,181,184,185,314,317,318,319,320,321,322,324,327, 424,425,426,427,428,429,439,440,441,442,443,445,44 6,447,448,449,451,453,467,468,470,471,472 |
| O00499-7 | 1.024 | 258 | 1.012 | 788.214 | 0.566 | 0.734 | 0.909 | 0.47 | 1.129 | 0.416 | 0.846 | 17,20,24,28,31,32,38,39,40,41,44,45,48,51,52,55,59 ,62,127,130,133,134,135,137,138,140,141,142,143,14 4,145,146,147,148,188,379,382,383,384,385,386,396, 397,398,399,400,402,403,404,405,408,410,424,425,42 6,427,428,429 |
| O00499-8 | 1.017 | 366 | 1.041 | 1159.34 | 0.582 | 0.712 | 0.886 | 0.579 | 1.001 | 0.578 | 1.01 | 17,19,20,21,23,24,26,27,28,30,31,32,38,39,40,41,44 ,45,48,51,52,55,59,62,63,66,127,130,133,134,135,13 7,138,139,140,141,142,143,144,145,146,147,148,149, 152,153,155,156,173,174,177,180,181,397,398,399,40 0,401,413,414,415,417,418,419,420,423,425,439,440, 441,442,443,444 |
| O00499-9 | 1.029 | 180 | 0.985 | 527.534 | 0.537 | 0.742 | 0.939 | 0.408 | 1.228 | 0.333 | 1.115 | 21,24,55,59,62,66,127,130,131,133,134,135,137,138, 140,141,142,145,146,352,353,354,355,368,369,370,37 3,374,375,378,380,394,395,397,398,399 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of O00499-1_O00499-1_2fic_B.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O00499-1_2fic_B_O00499-10.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-11.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-2.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-3.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-4.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-5.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-6.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-7.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-8.pdb |
| 3D view using mol* of O00499-1_2fic_B_O00499-9.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O00499-1_O00499-10.pdb |
| 3D view using mol* of O00499-1_O00499-11.pdb |
| 3D view using mol* of O00499-1_O00499-2.pdb |
| 3D view using mol* of O00499-1_O00499-3.pdb |
| 3D view using mol* of O00499-1_O00499-4.pdb |
| 3D view using mol* of O00499-1_O00499-5.pdb |
| 3D view using mol* of O00499-1_O00499-6.pdb |
| 3D view using mol* of O00499-1_O00499-7.pdb |
| 3D view using mol* of O00499-1_O00499-8.pdb |
| 3D view using mol* of O00499-1_O00499-9.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to BIN1 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to BIN1 |
Previous studies relating to the alternative splicing of BIN1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| BIN1 | 21623381 | Misregulated alternative splicing of BIN1 is associated with T tubule alterations and muscle weakness in myotonic dystrophy. | Myotonic dystrophy is the most common muscular dystrophy in adults and the first recognized example of an RNA-mediated disease. Congenital myotonic dystrophy (CDM1) and myotonic dystrophy of type 1 (DM1) or of type 2 (DM2) are caused by the expression of mutant RNAs containing expanded CUG or CCUG repeats, respectively. These mutant RNAs sequester the splicing regulator Muscleblind-like-1 (MBNL1), resulting in specific misregulation of the alternative splicing of other pre-mRNAs. We found that alternative splicing of the bridging integrator-1 (BIN1) pre-mRNA is altered in skeletal muscle samples of people with CDM1, DM1 and DM2. BIN1 is involved in tubular invaginations of membranes and is required for the biogenesis of muscle T tubules, which are specialized skeletal muscle membrane structures essential for excitation-contraction coupling. Mutations in the BIN1 gene cause centronuclear myopathy, which shares some histopathological features with myotonic dystrophy. We found that MBNL1 binds the BIN1 pre-mRNA and regulates its alternative splicing. BIN1 missplicing results in expression of an inactive form of BIN1 lacking phosphatidylinositol 5-phosphate-binding and membrane-tubulating activities. Consistent with a defect of BIN1, muscle T tubules are altered in people with myotonic dystrophy, and membrane structures are restored upon expression of the normal splicing form of BIN1 in muscle cells of such individuals. Finally, reproducing BIN1 splicing alteration in mice is sufficient to promote T tubule alterations and muscle weakness, a predominant feature of myotonic dystrophy. | D018908 | Muscle Weakness |
| BIN1 | 21623381 | Misregulated alternative splicing of BIN1 is associated with T tubule alterations and muscle weakness in myotonic dystrophy. | Myotonic dystrophy is the most common muscular dystrophy in adults and the first recognized example of an RNA-mediated disease. Congenital myotonic dystrophy (CDM1) and myotonic dystrophy of type 1 (DM1) or of type 2 (DM2) are caused by the expression of mutant RNAs containing expanded CUG or CCUG repeats, respectively. These mutant RNAs sequester the splicing regulator Muscleblind-like-1 (MBNL1), resulting in specific misregulation of the alternative splicing of other pre-mRNAs. We found that alternative splicing of the bridging integrator-1 (BIN1) pre-mRNA is altered in skeletal muscle samples of people with CDM1, DM1 and DM2. BIN1 is involved in tubular invaginations of membranes and is required for the biogenesis of muscle T tubules, which are specialized skeletal muscle membrane structures essential for excitation-contraction coupling. Mutations in the BIN1 gene cause centronuclear myopathy, which shares some histopathological features with myotonic dystrophy. We found that MBNL1 binds the BIN1 pre-mRNA and regulates its alternative splicing. BIN1 missplicing results in expression of an inactive form of BIN1 lacking phosphatidylinositol 5-phosphate-binding and membrane-tubulating activities. Consistent with a defect of BIN1, muscle T tubules are altered in people with myotonic dystrophy, and membrane structures are restored upon expression of the normal splicing form of BIN1 in muscle cells of such individuals. Finally, reproducing BIN1 splicing alteration in mice is sufficient to promote T tubule alterations and muscle weakness, a predominant feature of myotonic dystrophy. | D009223 | Myotonic Dystrophy |
Clinically important variants in BIN1 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|