Protein:MKNK2 |
Protein Summary |
 Gene summary |
| Gene name: MKNK2 | ASpdb.0 ID: 2872 | Gene | Gene symbol | MKNK2 | Gene ID | 2872 |
| Gene name | MAPK interacting serine/threonine kinase 2 |
| Synonyms | GPRK7|MNK2 |
| Cytomap | 19p13.3 |
| Type of gene | protein-coding |
| Description | MAP kinase-interacting serine/threonine-protein kinase 2G protein-coupled receptor kinase 7MAP kinase interacting serine/threonine kinase 2MAP kinase signal-integrating kinase 2MAPK signal-integrating kinase 2 |
| Modification date | 20240305 |
| UniProtAcc | Q9HBH9 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | MKNK2 | GO:0004674 | protein serine/threonine kinase activity | 11463832 |
| Gene | MKNK2 | GO:0005524 | ATP binding | 11463832 |
| Gene | MKNK2 | GO:0005654 | nucleoplasm | - |
| Gene | MKNK2 | GO:0006468 | protein phosphorylation | 11463832 |
| Gene | MKNK2 | GO:0016604 | nuclear body | - |
| Gene | MKNK2 | GO:0030097 | hemopoiesis | 21149447 |
| Gene | MKNK2 | GO:0035556 | intracellular signal transduction | 11463832 |
| Gene | MKNK2 | GO:0071243 | cellular response to arsenic-containing substance | 18299328 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q9HBH9-1 | Q9HBH9-1_2hw7_A.pdb | 2HW7 | X-ray | 2.71 | A | 72 | 371 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q9HBH9 | MKNK2 | Q9HBH9-1 | Q9HBH9-2 | 465 | 414 | 386 | 414 | Substitution | NSCAKDLTSFAAEAIAMNRQLAQHDEDLA | WDSHFLLPPHPCRIHVRPGGLVRTVTVNE | 386 | 414 |
| Q9HBH9 | MKNK2 | Q9HBH9-1 | Q9HBH9-2 | 465 | 414 | 415 | 465 | Deletion | none | none | 414 | 414 |
| Multiple sequence alignment of our canonical and alternatively spliced MKNK2 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MKNK2 |
| UniProt-id | ENSG | ENST | ENSP |
| Q9HBH9-1 | ENSG00000099875.16 | ENST00000250896.9 | ENSP00000250896.3 |
| Q9HBH9-2 | ENSG00000099875.16 | ENST00000309340.11 | ENSP00000309485.6 |
| UniProt-id | NM ID | NP ID |
| Q9HBH9-1 | NM_199054.2 | NP_951009.1 |
| Q9HBH9-2 | NM_017572.3 | NP_060042.2 |
| Amino acid sequences of our canonical and alternatively spliced MKNK2 |
| accession_id | Protein sequence |
| Q9HBH9-1 | MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVL GEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEAS IYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQRRQR |
| Q9HBH9-2 | MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVL GEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEAS IYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| MKNK2 (go to UniProt):Q9HBH9 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q9HBH9 | Domain | 84 | 388 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=386;End=414 |
| Q9HBH9 | Motif | 444 | 448 | Note=MAP kinase binding;Ontology_term=ECO:0000250;evidence=ECO:0000250 | Type=Deletion;Start=415;End=465 |
Gene Isoform Structures and Expression Levels for MKNK2 |
| Gene structures of our canonical and alternative spliced genes of MKNK2 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q9HBH9-1 |
| 3D view using mol* of Q9HBH9-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q9HBH9-1 |
 |
| pLDDT distribution across the protein length of Q9HBH9-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q9HBH9-1 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q9HBH9-1 | 1.025 | 183 | 1.053 | 599.907 | 0.625 | 0.713 | 0.911 | 0.836 | 0.966 | 0.866 | 0.693 | 90,91,92,93,94,95,96,97,98,111,113,115,122,125,126 ,129,133,143,159,161,162,163,164,165,166,168,169,1 70,173,205,207,208,209,210,212,216,217,225,226,227 ,228,229,230,389,390,393 |
| Q9HBH9-2 | 1.036 | 615 | 1.068 | 1884.442 | 0.592 | 0.721 | 0.877 | 0.664 | 0.933 | 0.711 | 1.045 | 90,91,92,93,94,95,96,98,111,113,115,122,125,126,12 9,133,143,159,160,161,162,163,165,166,167,168,169, 172,204,205,206,207,208,209,210,212,225,226,227,22 8,229,230,231,241,242,243,244,245,246,247,249,250, 251,252,253,254,255,256,257,258,260,261,262,263,26 4,265,266,267,269,272,273,276,280,287,291,292,293, 295,296,297,298,305,306,307,308,309,310,315,318,31 9,351,352,353,383,386,387,390,391,392,393,394,395, 396,397,398,399,400 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q9HBH9-1_Q9HBH9-1_2hw7_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q9HBH9-1_2hw7_A_Q9HBH9-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q9HBH9-1_Q9HBH9-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q9HBH9-1_vs_Q9HBH9-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q9HBH9-1_vs_Q9HBH9-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MKNK2 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| Q9HBH9 | MKNK2 | DB12010 | Fostamatinib | approved, investigational | inhibitor |
Related Diseases to MKNK2 |
| Previous studies relating to the alternative splicing of MKNK2 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MKNK2 | 18508592 | The Mnks: MAP kinase-interacting kinases (MAP kinase signal-integrating kinases). | The human MAP kinase-interacting kinases (or MAP kinase signal-integrating kinases), Mnks, comprise a group of four proteins derived from two genes (Gene symbols: MKNK1 and MKNK2) by alternative splicing. Mnk1a/b differ at their C-termini, as do Mnk2a/2b: in each case, the a-form possesses a longer C-terminal region than the b-form, which lacks the MAP kinase-binding region. The N-termini of all forms contain a polybasic region which binds importin a and the translation factor scaffold protein eukaryotic initiation factor (eIF) 4G. The catalytic domains of Mnk1a/b and Mnk2a/b share three unusual features: two short inserts and a DFD feature where other kinases have DFG. Mnk isoforms differ markedly in their activity and regulation, and in subcellular localization. The best-characterised Mnk substrate is eIF4E. The cellular role of eIF4E phosphorylation remains unclear: it may promote export of certain mRNAs from the nucleus. Other Mnk substrates bind to AU-rich elements that modulate the stability/translation of specific mRNAs. Mnks may also control production of inflammatory mediators and signaling from tyrosine kinase receptors, as well as cell proliferation or survival. | D009369 | Neoplasms |
Clinically important variants in MKNK2 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |