Protein:NR3C1 |
Protein Summary |
 Gene summary |
| Gene name: NR3C1 | ASpdb.0 ID: 2908 | Gene | Gene symbol | NR3C1 | Gene ID | 2908 |
| Gene name | nuclear receptor subfamily 3 group C member 1 |
| Synonyms | GCCR|GCR|GCRST|GR|GRL |
| Cytomap | 5q31.3 |
| Type of gene | protein-coding |
| Description | glucocorticoid receptornuclear receptor subfamily 3 group C member 1 variant hGR-B(54)nuclear receptor subfamily 3 group C member 1 variant hGR-B(77)nuclear receptor subfamily 3 group C member 1 variant hGR-B(93)nuclear receptor subfamily 3, group C, |
| Modification date | 20240416 |
| UniProtAcc | P04150 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | NR3C1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 1894621 |
| Gene | NR3C1 | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding | 1894621 |
| Gene | NR3C1 | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 16728402 |
| Gene | NR3C1 | GO:0001046 | core promoter sequence-specific DNA binding | 17081986 |
| Gene | NR3C1 | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific | 1894621 |
| Gene | NR3C1 | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific | 16728402|23823477|28139699 |
| Gene | NR3C1 | GO:0003700 | DNA-binding transcription factor activity | 15769988 |
| Gene | NR3C1 | GO:0004879 | nuclear receptor activity | 17635946 |
| Gene | NR3C1 | GO:0005496 | steroid binding | 15769988 |
| Gene | NR3C1 | GO:0005634 | nucleus | 28139699 |
| Gene | NR3C1 | GO:0005634 | nucleus | 9353307|15769988|17635946|22022502|23878391 |
| Gene | NR3C1 | GO:0005654 | nucleoplasm | - |
| Gene | NR3C1 | GO:0005737 | cytoplasm | 15769988|17635946|22022502 |
| Gene | NR3C1 | GO:0005829 | cytosol | - |
| Gene | NR3C1 | GO:0006355 | regulation of DNA-templated transcription | 17081986|19141540 |
| Gene | NR3C1 | GO:0016607 | nuclear speck | 9353307 |
| Gene | NR3C1 | GO:0032991 | protein-containing complex | 26593036 |
| Gene | NR3C1 | GO:0045892 | negative regulation of DNA-templated transcription | 1894621 |
| Gene | NR3C1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 15769988|16728402|23823477 |
| Gene | NR3C1 | GO:0071383 | cellular response to steroid hormone stimulus | 15769988|17635946 |
| Gene | NR3C1 | GO:0071385 | cellular response to glucocorticoid stimulus | 9353307|28139699 |
| Gene | NR3C1 | GO:0071560 | cellular response to transforming growth factor beta stimulus | 12902338 |
| Gene | NR3C1 | GO:1902895 | positive regulation of miRNA transcription | 27334923 |
| Gene | NR3C1 | GO:1990239 | steroid hormone binding | 17635946 |
| Gene | NR3C1 | GO:1990837 | sequence-specific double-stranded DNA binding | 28473536 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P04150-1 | P04150-1_1m2z_A.pdb | 1M2Z | X-ray | 2.5 | A | 523 | 777 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P04150 | NR3C1 | P04150-1 | P04150-10 | 777 | 751 | 313 | 338 | Deletion | none | none | 312 | 312 |
| P04150 | NR3C1 | P04150-1 | P04150-11 | 777 | 692 | 1 | 85 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-12 | 777 | 688 | 1 | 89 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-13 | 777 | 680 | 1 | 97 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-14 | 777 | 462 | 1 | 315 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-15 | 777 | 447 | 1 | 330 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-16 | 777 | 442 | 1 | 335 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-2 | 777 | 742 | 728 | 777 | Substitution | VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK | NVMWLKPESTSHTLI | 728 | 742 |
| P04150 | NR3C1 | P04150-1 | P04150-3 | 777 | 778 | 451 | 451 | Substitution | G | GR | 451 | 452 |
| P04150 | NR3C1 | P04150-1 | P04150-5 | 777 | 593 | 491 | 674 | Deletion | none | none | 490 | 490 |
| P04150 | NR3C1 | P04150-1 | P04150-6 | 777 | 743 | 451 | 451 | Substitution | G | GR | 451 | 452 |
| P04150 | NR3C1 | P04150-1 | P04150-6 | 777 | 743 | 728 | 777 | Substitution | VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK | NVMWLKPESTSHTLI | 729 | 743 |
| P04150 | NR3C1 | P04150-1 | P04150-7 | 777 | 558 | 491 | 674 | Deletion | none | none | 490 | 490 |
| P04150 | NR3C1 | P04150-1 | P04150-7 | 777 | 558 | 728 | 777 | Substitution | VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK | NVMWLKPESTSHTLI | 544 | 558 |
| P04150 | NR3C1 | P04150-1 | P04150-8 | 777 | 751 | 1 | 26 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-9 | 777 | 716 | 1 | 26 | Deletion | none | none | 0 | 0 |
| P04150 | NR3C1 | P04150-1 | P04150-9 | 777 | 716 | 728 | 777 | Substitution | VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK | NVMWLKPESTSHTLI | 702 | 716 |
| Multiple sequence alignment of our canonical and alternatively spliced NR3C1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of NR3C1 |
| UniProt-id | ENSG | ENST | ENSP |
| P04150-1 | ENSG00000113580.15 | ENST00000343796.6 | ENSP00000343205.2 |
| P04150-1 | ENSG00000113580.15 | ENST00000394464.7 | ENSP00000377977.2 |
| P04150-1 | ENSG00000113580.15 | ENST00000503201.1 | ENSP00000427672.1 |
| P04150-10 | ENSG00000113580.15 | ENST00000424646.6 | ENSP00000405282.2 |
| P04150-2 | ENSG00000113580.15 | ENST00000415690.6 | ENSP00000387672.2 |
| P04150-3 | ENSG00000113580.15 | ENST00000231509.7 | ENSP00000231509.3 |
| P04150-3 | ENSG00000113580.15 | ENST00000394466.6 | ENSP00000377979.2 |
| P04150-3 | ENSG00000113580.15 | ENST00000504572.5 | ENSP00000422518.1 |
| UniProt-id | NM ID | NP ID |
| P04150-1 | NM_000176.2 | NP_000167.1 |
| P04150-1 | NM_001018074.1 | NP_001018084.1 |
| P04150-1 | NM_001018075.1 | NP_001018085.1 |
| P04150-1 | NM_001018076.1 | NP_001018086.1 |
| P04150-1 | NM_001018077.1 | NP_001018087.1 |
| P04150-11 | NM_001204259.1 | NP_001191188.1 |
| P04150-12 | NM_001204260.1 | NP_001191189.1 |
| P04150-13 | NM_001204261.1 | NP_001191190.1 |
| P04150-14 | NM_001204262.1 | NP_001191191.1 |
| P04150-15 | NM_001204263.1 | NP_001191192.1 |
| P04150-16 | NM_001204264.1 | NP_001191193.1 |
| P04150-2 | NM_001020825.1 | NP_001018661.1 |
| P04150-3 | NM_001024094.1 | NP_001019265.1 |
| P04150-8 | NM_001204258.1 | NP_001191187.1 |
| Amino acid sequences of our canonical and alternatively spliced NR3C1 |
| accession_id | Protein sequence |
| P04150-1 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIIN EQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK |
| P04150-10 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGR TVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNML GGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRL QVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMS |
| P04150-11 | MGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTG TNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVL SSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP PIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFF KRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSL LEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAP DLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF |
| P04150-12 | MGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGG NVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPS NVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPV GSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAV EGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVI EPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLII NEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT |
| P04150-13 | MGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTD QSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVK TEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRC QGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLC AGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAG YDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLP CMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHE |
| P04150-14 | MSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSP PSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKK KIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFR NLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSV PKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYS |
| P04150-15 | MYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQE TSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIR |
| P04150-16 | MNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCS DEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENP GNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMA FALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIK |
| P04150-2 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIIN EQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK |
| P04150-3 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVI EPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLII NEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT |
| P04150-5 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEAVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDS |
| P04150-6 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVI EPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLII NEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT |
| P04150-7 | MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYM GETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSN VTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEAVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDS |
| P04150-8 | MDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGE TDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGK ETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEK LGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGR TVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNML GGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRL QVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMS |
| P04150-9 | MDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGE TDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGK ETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEK LGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGR TVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNML GGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| NR3C1 (go to UniProt):P04150 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=728;End=777 |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=491;End=674 |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=728;End=777 |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Deletion;Start=491;End=674 |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=728;End=777 |
| P04150 | Domain | 524 | 758 | Note=NR LBD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01189 | Type=Substitution;Start=728;End=777 |
| P04150 | DNA binding | 418 | 493 | Note=Nuclear receptor;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00407 | Type=Substitution;Start=451;End=451 |
| P04150 | DNA binding | 418 | 493 | Note=Nuclear receptor;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00407 | Type=Deletion;Start=491;End=674 |
| P04150 | DNA binding | 418 | 493 | Note=Nuclear receptor;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00407 | Type=Substitution;Start=451;End=451 |
| P04150 | DNA binding | 418 | 493 | Note=Nuclear receptor;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00407 | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=313;End=338 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=85 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=89 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=97 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=315 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=330 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=335 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=26 |
| P04150 | Region | 1 | 420 | Note=Modulating | Type=Deletion;Start=1;End=26 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=85 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=89 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=97 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=315 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=330 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=335 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=26 |
| P04150 | Region | 1 | 23 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=26 |
| P04150 | Region | 98 | 115 | Note=Required for high transcriptional activity of isoform Alpha-C3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23820903;Dbxref=PMID:23820903 | Type=Deletion;Start=1;End=315 |
| P04150 | Region | 98 | 115 | Note=Required for high transcriptional activity of isoform Alpha-C3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23820903;Dbxref=PMID:23820903 | Type=Deletion;Start=1;End=330 |
| P04150 | Region | 98 | 115 | Note=Required for high transcriptional activity of isoform Alpha-C3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23820903;Dbxref=PMID:23820903 | Type=Deletion;Start=1;End=335 |
| P04150 | Region | 130 | 183 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=315 |
| P04150 | Region | 130 | 183 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=330 |
| P04150 | Region | 130 | 183 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=335 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 487 | 523 | Note=Hinge | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 487 | 523 | Note=Hinge | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 532 | 697 | Note=Interaction with CRY1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22170608;Dbxref=PMID:22170608 | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 532 | 697 | Note=Interaction with CRY1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22170608;Dbxref=PMID:22170608 | Type=Deletion;Start=491;End=674 |
| P04150 | Compositional bias | 130 | 149 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=315 |
| P04150 | Compositional bias | 130 | 149 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=330 |
| P04150 | Compositional bias | 130 | 149 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=335 |
| P04150 | Compositional bias | 166 | 183 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=315 |
| P04150 | Compositional bias | 166 | 183 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=330 |
| P04150 | Compositional bias | 166 | 183 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=335 |
Gene Isoform Structures and Expression Levels for NR3C1 |
| Gene structures of our canonical and alternative spliced genes of NR3C1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P04150-1 |
| 3D view using mol* of P04150-10 |
| 3D view using mol* of P04150-11 |
| 3D view using mol* of P04150-12 |
| 3D view using mol* of P04150-13 |
| 3D view using mol* of P04150-14 |
| 3D view using mol* of P04150-15 |
| 3D view using mol* of P04150-16 |
| 3D view using mol* of P04150-2 |
| 3D view using mol* of P04150-3 |
| 3D view using mol* of P04150-5 |
| 3D view using mol* of P04150-6 |
| 3D view using mol* of P04150-7 |
| 3D view using mol* of P04150-8 |
| 3D view using mol* of P04150-9 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P04150-1 |
 |
| pLDDT distribution across the protein length of P04150-10 |
 |
| pLDDT distribution across the protein length of P04150-11 |
 |
| pLDDT distribution across the protein length of P04150-12 |
 |
| pLDDT distribution across the protein length of P04150-13 |
 |
| pLDDT distribution across the protein length of P04150-14 |
 |
| pLDDT distribution across the protein length of P04150-15 |
 |
| pLDDT distribution across the protein length of P04150-16 |
 |
| pLDDT distribution across the protein length of P04150-2 |
 |
| pLDDT distribution across the protein length of P04150-3 |
 |
| pLDDT distribution across the protein length of P04150-5 |
 |
| pLDDT distribution across the protein length of P04150-6 |
 |
| pLDDT distribution across the protein length of P04150-7 |
 |
| pLDDT distribution across the protein length of P04150-8 |
 |
| pLDDT distribution across the protein length of P04150-9 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P04150-1 |
 |
| Ramachandran plot of P04150-11 |
 |
| Ramachandran plot of P04150-12 |
 |
| Ramachandran plot of P04150-13 |
 |
| Ramachandran plot of P04150-14 |
 |
| Ramachandran plot of P04150-16 |
 |
| Ramachandran plot of P04150-2 |
 |
| Ramachandran plot of P04150-5 |
 |
| Ramachandran plot of P04150-6 |
 |
| Ramachandran plot of P04150-8 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P04150-1 | 1.261 | 129 | 1.314 | 181.447 | 0.279 | 0.976 | 1.239 | 3.057 | 0.649 | 4.712 | 3.38 | 559,560,563,564,566,567,570,600,601,604,605,607,60 8,611,623,629,639,642,643,646,732,735,736,749,753 |
| P04150-10 | 1.277 | 102 | 1.339 | 150.577 | 0.297 | 0.977 | 1.238 | 3.173 | 0.572 | 5.542 | 2.829 | 534,537,538,540,541,544,574,575,578,579,581,582,58 5,597,603,613,616,617,620,706,709,710,727 |
| P04150-11 | 1.286 | 123 | 1.355 | 164.297 | 0.217 | 0.979 | 1.211 | 3.268 | 0.528 | 6.195 | 3.734 | 475,478,479,481,482,485,515,516,519,520,522,523,52 6,538,544,554,557,558,561,647,650,651,664,668 |
| P04150-12 | 1.257 | 126 | 1.307 | 176.645 | 0.308 | 0.975 | 1.212 | 2.872 | 0.67 | 4.288 | 3.014 | 470,471,474,475,477,478,481,511,512,515,516,518,51 9,522,534,540,550,553,554,557,643,646,647,660,664 |
| P04150-13 | 1.246 | 120 | 1.287 | 173.215 | 0.286 | 0.977 | 1.249 | 2.45 | 0.733 | 3.345 | 2.788 | 462,463,466,467,469,470,473,503,504,507,508,510,51 1,514,526,532,536,542,545,546,549,635,638,639,642, 650,652,656 |
| P04150-14 | 1.271 | 119 | 1.329 | 173.558 | 0.296 | 0.979 | 1.206 | 3.017 | 0.61 | 4.943 | 2.572 | 245,248,249,251,252,255,285,286,289,290,292,293,29 6,308,324,327,331,417,420,421,424,432,434,438 |
| P04150-15 | 1.259 | 113 | 1.309 | 170.471 | 0.289 | 0.978 | 1.205 | 2.904 | 0.67 | 4.333 | 2.998 | 230,233,234,236,237,240,270,271,274,275,277,278,28 1,293,299,309,312,313,316,402,405,406,419,423 |
| P04150-16 | 1.269 | 109 | 1.324 | 170.814 | 0.268 | 0.981 | 1.262 | 2.89 | 0.627 | 4.611 | 3.93 | 225,228,229,231,232,235,265,266,269,270,273,276,28 8,294,304,307,311,397,400,401,414,418 |
| P04150-2 | 1.191 | 106 | 1.27 | 173.901 | 0.448 | 0.836 | 1.118 | 2.898 | 0.528 | 5.486 | 1.48 | 560,563,566,567,568,570,571,600,601,604,605,607,60 8,611,623,646,729,732,733,734,741,742 |
| P04150-3 | 1.281 | 126 | 1.348 | 158.466 | 0.222 | 0.976 | 1.273 | 3.042 | 0.544 | 5.589 | 2.505 | 560,561,564,565,567,568,571,601,602,605,606,608,60 9,612,624,630,640,643,644,647,733,736,737,750,754 |
| P04150-5 | 0.987 | 124 | 1.026 | 365.295 | 0.642 | 0.643 | 0.842 | 0.564 | 0.92 | 0.613 | 0.701 | 190,193,285,286,287,288,289,290,291,292,293,294,29 5,506,536,537,539,540,542,543,586,587,588,589,590, 591,592,593 |
| P04150-6 | 1.258 | 100 | 1.33 | 158.123 | 0.371 | 0.934 | 1.238 | 3.818 | 0.521 | 7.328 | 1.54 | 561,564,565,567,568,569,571,572,601,602,605,606,60 8,609,612,624,640,643,644,647,668,733,742,743 |
| P04150-7 | 1.084 | 126 | 1.155 | 361.865 | 0.514 | 0.71 | 0.972 | 1.373 | 0.647 | 2.123 | 1.09 | 431,432,433,434,436,442,490,491,492,496,497,498,49 9,502,505,506,509,538,541,544,545,548,549,550 |
| P04150-8 | 1.266 | 121 | 1.322 | 182.476 | 0.284 | 0.976 | 1.227 | 2.973 | 0.626 | 4.746 | 2.839 | 533,534,537,538,540,541,544,574,575,578,579,582,58 5,597,603,613,616,617,620,706,709,710,723,727 |
| P04150-9 | 1.237 | 95 | 1.294 | 131.369 | 0.326 | 0.951 | 1.256 | 3.41 | 0.59 | 5.782 | 1.24 | 534,537,538,540,541,542,544,545,574,575,578,579,58 1,582,585,597,613,616,617,620,706,714,715,716 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P04150-1_P04150-1_1m2z_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P04150-1_1m2z_A_P04150-10.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-11.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-12.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-13.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-14.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-15.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-16.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-2.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-3.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-5.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-6.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-7.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-8.pdb |
| 3D view using mol* of P04150-1_1m2z_A_P04150-9.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P04150-1_P04150-10.pdb |
| 3D view using mol* of P04150-1_P04150-11.pdb |
| 3D view using mol* of P04150-1_P04150-12.pdb |
| 3D view using mol* of P04150-1_P04150-13.pdb |
| 3D view using mol* of P04150-1_P04150-14.pdb |
| 3D view using mol* of P04150-1_P04150-15.pdb |
| 3D view using mol* of P04150-1_P04150-16.pdb |
| 3D view using mol* of P04150-1_P04150-2.pdb |
| 3D view using mol* of P04150-1_P04150-3.pdb |
| 3D view using mol* of P04150-1_P04150-5.pdb |
| 3D view using mol* of P04150-1_P04150-6.pdb |
| 3D view using mol* of P04150-1_P04150-7.pdb |
| 3D view using mol* of P04150-1_P04150-8.pdb |
| 3D view using mol* of P04150-1_P04150-9.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-10.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-11.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-12.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-13.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-14.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-15.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-16.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-2.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-3.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-5.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-6.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-7.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-8.png |
 < |
| ./stats/secondary_structure/figure/P04150-1_vs_P04150-9.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P04150-1_vs_P04150-10.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-11.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-12.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-13.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-14.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-15.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-16.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-2.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-3.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-5.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-6.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-7.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-8.png |
 < |
| ./stats/relative_asa/P04150-1_vs_P04150-9.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 485 | 777 | Note=Interaction with CLOCK | Type=Substitution;Start=728;End=777 |
| P04150 | Region | 532 | 697 | Note=Interaction with CRY1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22170608;Dbxref=PMID:22170608 | Type=Deletion;Start=491;End=674 |
| P04150 | Region | 532 | 697 | Note=Interaction with CRY1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22170608;Dbxref=PMID:22170608 | Type=Deletion;Start=491;End=674 |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to NR3C1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P04150 | NR3C1 | DB14631 | Prednisolone phosphate | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00663 | Flumethasone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00443 | Betamethasone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00253 | Medrysone | approved | agonist |
| P04150 | NR3C1 | DB01013 | Clobetasol propionate | approved | agonist |
| P04150 | NR3C1 | DB15566 | Prednisolone acetate | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00741 | Hydrocortisone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00717 | Norethisterone | approved | agonist |
| P04150 | NR3C1 | DB08867 | Ulipristal | approved | antagonist |
| P04150 | NR3C1 | DB14583 | Segesterone acetate | approved, experimental, investigational | agonist |
| P04150 | NR3C1 | DB14649 | Dexamethasone acetate | approved, investigational, vet_approved | agonist |
| P04150 | NR3C1 | DB00180 | Flunisolide | approved, investigational | agonist |
| P04150 | NR3C1 | DB00687 | Fludrocortisone | approved, investigational | agonist |
| P04150 | NR3C1 | DB00959 | Methylprednisolone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00288 | Amcinonide | approved | agonist |
| P04150 | NR3C1 | DB14669 | Betamethasone phosphate | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB05423 | ORG-34517 | investigational | |
| P04150 | NR3C1 | DB14542 | Hydrocortisone phosphate | approved, vet_approved | |
| P04150 | NR3C1 | DB14541 | Hydrocortisone cypionate | approved, investigational, vet_approved | |
| P04150 | NR3C1 | DB01185 | Fluoxymesterone | approved, illicit | antagonist |
| P04150 | NR3C1 | DB00620 | Triamcinolone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00834 | Mifepristone | approved, investigational | antagonist |
| P04150 | NR3C1 | DB08906 | Fluticasone furoate | approved | agonist |
| P04150 | NR3C1 | DB14540 | Hydrocortisone butyrate | approved, vet_approved | |
| P04150 | NR3C1 | DB00351 | Megestrol acetate | approved, investigational, vet_approved | agonist |
| P04150 | NR3C1 | DB00838 | Clocortolone | approved | agonist |
| P04150 | NR3C1 | DB00547 | Desoximetasone | approved | agonist |
| P04150 | NR3C1 | DB00367 | Levonorgestrel | approved, investigational | binder |
| P04150 | NR3C1 | DB14539 | Hydrocortisone acetate | approved, vet_approved | |
| P04150 | NR3C1 | DB13158 | Clobetasone | approved | agonist |
| P04150 | NR3C1 | DB01130 | Prednicarbate | approved, investigational | agonist |
| P04150 | NR3C1 | DB00846 | Flurandrenolide | approved | agonist |
| P04150 | NR3C1 | DB00896 | Rimexolone | approved | agonist |
| P04150 | NR3C1 | DB00596 | Ulobetasol | approved | agonist |
| P04150 | NR3C1 | DB00324 | Fluorometholone | approved, investigational | agonist |
| P04150 | NR3C1 | DB13867 | Fluticasone | approved, experimental | agonist |
| P04150 | NR3C1 | DB00860 | Prednisolone | approved, vet_approved | agonist |
| P04150 | NR3C1 | DB00591 | Fluocinolone acetonide | approved, investigational, vet_approved | agonist |
| P04150 | NR3C1 | DB04630 | Aldosterone | experimental, investigational | |
| P04150 | NR3C1 | DB00588 | Fluticasone propionate | approved | agonist |
| P04150 | NR3C1 | DB14596 | Loteprednol etabonate | approved | agonist |
| P04150 | NR3C1 | DB14538 | Hydrocortisone aceponate | experimental, vet_approved | |
| P04150 | NR3C1 | DB12637 | Onapristone | investigational | |
| P04150 | NR3C1 | DB02210 | Hexane-1,6-Diol | experimental | |
| P04150 | NR3C1 | DB01222 | Budesonide | approved | agonist |
| P04150 | NR3C1 | DB00223 | Diflorasone | approved | agonist |
| P04150 | NR3C1 | DB00421 | Spironolactone | approved | antagonist |
| P04150 | NR3C1 | DB01047 | Fluocinonide | approved, investigational | agonist |
| P04150 | NR3C1 | DB13003 | Cortivazol | investigational | |
| P04150 | NR3C1 | DB11921 | Deflazacort | approved, investigational | agonist |
| P04150 | NR3C1 | DB00240 | Alclometasone | approved | agonist |
| P04150 | NR3C1 | DB15114 | Vamorolone | approved, investigational | agonist |
| P04150 | NR3C1 | DB00764 | Mometasone | experimental | agonist |
| P04150 | NR3C1 | DB01410 | Ciclesonide | approved, investigational | agonist |
| P04150 | NR3C1 | DB00769 | Hydrocortamate | approved | agonist |
| P04150 | NR3C1 | DB01395 | Drospirenone | approved | binder |
| P04150 | NR3C1 | DB14543 | Hydrocortisone probutate | approved, vet_approved | |
| P04150 | NR3C1 | DB01380 | Cortisone acetate | approved, investigational | agonist |
| P04150 | NR3C1 | DB01384 | Paramethasone | experimental | agonist |
| P04150 | NR3C1 | DB14512 | Mometasone furoate | approved, investigational, vet_approved | |
| P04150 | NR3C1 | DB11619 | Gestrinone | approved | antagonist |
| P04150 | NR3C1 | DB14544 | Hydrocortisone valerate | approved, vet_approved | |
| P04150 | NR3C1 | DB00396 | Progesterone | approved, vet_approved | partial agonist |
| P04150 | NR3C1 | DB06781 | Difluprednate | approved | agonist |
| P04150 | NR3C1 | DB00394 | Beclomethasone dipropionate | approved, investigational | agonist |
| P04150 | NR3C1 | DB01260 | Desonide | approved, investigational | agonist |
| P04150 | NR3C1 | DB09095 | Difluocortolone | approved, investigational, withdrawn | binder |
| P04150 | NR3C1 | DB09091 | Tixocortol | approved, withdrawn | binder |
| P04150 | NR3C1 | DB01234 | Dexamethasone | approved, investigational, vet_approved | agonist |
| P04150 | NR3C1 | DB00635 | Prednisone | approved, vet_approved | agonist |
Related Diseases to NR3C1 |
| Previous studies relating to the alternative splicing of NR3C1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| NR3C1 | 11358809 | Expression in hematological malignancies of a glucocorticoid receptor splice variant that augments glucocorticoid receptor-mediated effects in transfected cells. | Glucocorticoids play an important role in the treatment of a number of hematological malignancies, such as multiple myeloma. The effects of glucocorticoids are mediated through the glucocorticoid receptor alpha, the abundance of which can be modulated by alternative splicing of the glucocorticoid receptor mRNA. Two splice variants of the glucocorticoid receptor mRNA have been described: glucocorticoid receptor beta, which reportedly has a dominant negative effect on the actions of the glucocorticoid receptor alpha, and glucocorticoid receptor P, of which the effects are unknown. In this study, we have investigated the expression levels of these two splice variants at the mRNA level in multiple myeloma cells and in a number of other hematological tumors. Although the glucocorticoid receptor beta mRNA was, if at all, expressed at very low levels, considerable amounts (up to 50% of the total glucocorticoid receptor mRNA) glucocorticoid receptor P mRNA was present in most hematological malignancies. In transient transfection studies in several cell types and in multiple myeloma cell lines, the glucocorticoid receptor P increased the activity of the glucocorticoid receptor alpha. These results suggest that the relative levels of the glucocorticoid receptor alpha and the glucocorticoid receptor P may play a role in the occurrence of glucocorticoid resistance in tumor cells during the treatment of hematological malignancies with glucocorticoids. | D019337 | Hematologic Neoplasms |
| NR3C1 | 11358809 | Expression in hematological malignancies of a glucocorticoid receptor splice variant that augments glucocorticoid receptor-mediated effects in transfected cells. | Glucocorticoids play an important role in the treatment of a number of hematological malignancies, such as multiple myeloma. The effects of glucocorticoids are mediated through the glucocorticoid receptor alpha, the abundance of which can be modulated by alternative splicing of the glucocorticoid receptor mRNA. Two splice variants of the glucocorticoid receptor mRNA have been described: glucocorticoid receptor beta, which reportedly has a dominant negative effect on the actions of the glucocorticoid receptor alpha, and glucocorticoid receptor P, of which the effects are unknown. In this study, we have investigated the expression levels of these two splice variants at the mRNA level in multiple myeloma cells and in a number of other hematological tumors. Although the glucocorticoid receptor beta mRNA was, if at all, expressed at very low levels, considerable amounts (up to 50% of the total glucocorticoid receptor mRNA) glucocorticoid receptor P mRNA was present in most hematological malignancies. In transient transfection studies in several cell types and in multiple myeloma cell lines, the glucocorticoid receptor P increased the activity of the glucocorticoid receptor alpha. These results suggest that the relative levels of the glucocorticoid receptor alpha and the glucocorticoid receptor P may play a role in the occurrence of glucocorticoid resistance in tumor cells during the treatment of hematological malignancies with glucocorticoids. | D009101 | Multiple Myeloma |
| NR3C1 | 17540466 | Bombesin attenuates pre-mRNA splicing of glucocorticoid receptor by regulating the expression of serine-arginine protein p30c (SRp30c) in prostate cancer cells. | Although glucocorticoids are frequently administered to patients with hormone refractory prostate cancer, their therapeutic effectiveness is limited by the development of glucocorticoid resistance. The molecular mechanisms of glucocorticoid resistance are unknown but are believed to involve neuropeptide growth factors and cytokines. We examined the functional interaction between bombesin and dexamethasone in PC-3 cells and found that bombesin could act as a survival factor by interfering with dexamethasone-mediated growth inhibition. Because glucocorticoids exert their effects through glucocorticoid receptors (GRs), we measured the expression of GR alpha and GR beta isoforms in the presence of bombesin. Western blotting and real time PCR revealed bombesin induced expression of GR beta, but not GR alpha. Because GR isoforms are generated by alternative splicing of a common GR gene, we examined the expression of serine-arginine (SR) proteins involved in alternative splicing, and found that the expression of SRp30 was induced by bombesin in PC-3 cells. To characterize the role of SRp30 in splicing of GR isoforms, siRNAs specific to various SRp30 isoforms were transfected into PC-3 cells. We found that suppression of SRp30c expression by siRNA specifically antagonized bombesin's effect on glucocorticoid-mediated inhibition of PC cells, suggesting that bombesin-induced expression of SRp30c affects GR pre-mRNA splicing, leading to increased GR beta expression and contributing to glucocorticoid resistance in PC cells. | D011471 | Prostatic Neoplasms |
| NR3C1 | 20376328 | Assessment of SNPs associated with the human glucocorticoid receptor in primary open-angle glaucoma and steroid responders. | "While chronic glucocorticoid (GC) therapy leads to ocular hypertension in about one third of individuals, almost all primary open-angle glaucoma (POAG) patients show this response and are called ""steroid responders."" Two differentially spliced isoforms of the glucocorticoid receptor (GR), GRalpha and GRbeta, regulate GC responsiveness in trabecular meshwork (TM) cells. GRbeta acts as a dominant negative regulator of GC activity and is expressed at lower levels in glaucomatous TM cells, making them more sensitive to GCs. Several arginine/serine-rich splicing factor (SR) proteins have been implicated in alternative splicing of the GR. We have previously demonstrated that immunophilins FKBP5 and FKBP4 are required for GRalpha and GRbeta translocation into the nucleus, which is essential for their biologic activity. The purpose of the present study was to use single nucleotide polymorphism (SNP) genotyping to determine whether there are any allele frequency differences in GR, FKBP4/5, or SR genes between normal control, POAG, and steroid responder populations." | D020022 | Genetic Predisposition to Disease |
| NR3C1 | 20376328 | Assessment of SNPs associated with the human glucocorticoid receptor in primary open-angle glaucoma and steroid responders. | "While chronic glucocorticoid (GC) therapy leads to ocular hypertension in about one third of individuals, almost all primary open-angle glaucoma (POAG) patients show this response and are called ""steroid responders."" Two differentially spliced isoforms of the glucocorticoid receptor (GR), GRalpha and GRbeta, regulate GC responsiveness in trabecular meshwork (TM) cells. GRbeta acts as a dominant negative regulator of GC activity and is expressed at lower levels in glaucomatous TM cells, making them more sensitive to GCs. Several arginine/serine-rich splicing factor (SR) proteins have been implicated in alternative splicing of the GR. We have previously demonstrated that immunophilins FKBP5 and FKBP4 are required for GRalpha and GRbeta translocation into the nucleus, which is essential for their biologic activity. The purpose of the present study was to use single nucleotide polymorphism (SNP) genotyping to determine whether there are any allele frequency differences in GR, FKBP4/5, or SR genes between normal control, POAG, and steroid responder populations." | D005902 | Glaucoma, Open-Angle |
Clinically important variants in NR3C1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |