Protein:GSK3B |
Protein Summary |
 Gene summary |
| Gene name: GSK3B | ASpdb.0 ID: 2932 | Gene | Gene symbol | GSK3B | Gene ID | 2932 |
| Gene name | glycogen synthase kinase 3 beta |
| Synonyms | - |
| Cytomap | 3q13.33 |
| Type of gene | protein-coding |
| Description | glycogen synthase kinase-3 betaGSK-3 betaserine/threonine-protein kinase GSK3B |
| Modification date | 20240411 |
| UniProtAcc | P49841 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | GSK3B | GO:0002039 | p53 binding | 14744935 |
| Gene | GSK3B | GO:0004674 | protein serine/threonine kinase activity | 8638126|9072970|11035810|11104755|11955436|14744935|15448698|16315267|17139249|18348280|19364825|28992046|29142209 |
| Gene | GSK3B | GO:0005634 | nucleus | 12223487|14744935|15448698 |
| Gene | GSK3B | GO:0005654 | nucleoplasm | - |
| Gene | GSK3B | GO:0005737 | cytoplasm | 12223487|14744935|15448698|18787224|19038973|20937854 |
| Gene | GSK3B | GO:0005813 | centrosome | 17139249|21399614 |
| Gene | GSK3B | GO:0005886 | plasma membrane | 20937854 |
| Gene | GSK3B | GO:0005977 | glycogen metabolic process | 8638126 |
| Gene | GSK3B | GO:0006468 | protein phosphorylation | 11035810|16315267|20937854 |
| Gene | GSK3B | GO:0006983 | ER overload response | 14744935 |
| Gene | GSK3B | GO:0016301 | kinase activity | 15448698|24391509 |
| Gene | GSK3B | GO:0018105 | peptidyl-serine phosphorylation | 11104755|14744935 |
| Gene | GSK3B | GO:0018105 | peptidyl-serine phosphorylation | 8638126|11955436|17139249 |
| Gene | GSK3B | GO:0018107 | peptidyl-threonine phosphorylation | 11955436|17139249|25897075 |
| Gene | GSK3B | GO:0030877 | beta-catenin destruction complex | 8638126|9601641|16188939 |
| Gene | GSK3B | GO:0031175 | neuron projection development | 19830702 |
| Gene | GSK3B | GO:0031334 | positive regulation of protein-containing complex assembly | 8638126 |
| Gene | GSK3B | GO:0031398 | positive regulation of protein ubiquitination | 29142209 |
| Gene | GSK3B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | 19364825|22660580 |
| Gene | GSK3B | GO:0035556 | intracellular signal transduction | 14749367 |
| Gene | GSK3B | GO:0043066 | negative regulation of apoptotic process | 14744935 |
| Gene | GSK3B | GO:0046777 | protein autophosphorylation | 23184662 |
| Gene | GSK3B | GO:0046825 | regulation of protein export from nucleus | 12223487 |
| Gene | GSK3B | GO:0046827 | positive regulation of protein export from nucleus | 14744935 |
| Gene | GSK3B | GO:0050321 | tau-protein kinase activity | 14690523|16365045 |
| Gene | GSK3B | GO:0060070 | canonical Wnt signaling pathway | 16890161 |
| Gene | GSK3B | GO:0098978 | glutamatergic synapse | 17989287 |
| Gene | GSK3B | GO:0099171 | presynaptic modulation of chemical synaptic transmission | 17989287 |
| Gene | GSK3B | GO:1904886 | beta-catenin destruction complex disassembly | 10428961 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P49841-1 | P49841-1_4nm3_A.pdb | 4NM3 | X-ray | 2.1 | A | 6 | 383 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P49841 | GSK3B | P49841-1 | P49841-2 | 420 | 433 | 303 | 303 | Substitution | K | KDSSGTGHFTSGVR | 303 | 316 |
| Multiple sequence alignment of our canonical and alternatively spliced GSK3B |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of GSK3B |
| UniProt-id | ENSG | ENST | ENSP |
| P49841-1 | ENSG00000082701.17 | ENST00000264235.13 | ENSP00000264235.9 |
| P49841-2 | ENSG00000082701.17 | ENST00000316626.6 | ENSP00000324806.5 |
| UniProt-id | NM ID | NP ID |
| P49841-1 | NM_001146156.1 | NP_001139628.1 |
| P49841-2 | NM_002093.3 | NP_002084.2 |
| Amino acid sequences of our canonical and alternatively spliced GSK3B |
| accession_id | Protein sequence |
| P49841-1 | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQD KRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII KVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF |
| P49841-2 | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQD KRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII KVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| GSK3B (go to UniProt):P49841 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P49841 | Domain | 56 | 340 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Substitution;Start=303;End=303 |
Gene Isoform Structures and Expression Levels for GSK3B |
| Gene structures of our canonical and alternative spliced genes of GSK3B * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P49841-1 |
| 3D view using mol* of P49841-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P49841-1 |
 |
| pLDDT distribution across the protein length of P49841-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P49841-1 |
 |
| Ramachandran plot of P49841-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P49841-1 | 1.052 | 184 | 1.081 | 409.542 | 0.401 | 0.748 | 1.051 | 0.976 | 0.944 | 1.034 | 1.012 | 14,16,17,19,20,22,23,24,41,42,43,51,89,91,92,93,94 ,95,98,99,102,115,116,117,126 |
| P49841-2 | 1.062 | 101 | 1.079 | 392.735 | 0.524 | 0.782 | 0.944 | 0.932 | 1.015 | 0.919 | 0.966 | 4,62,63,65,66,67,70,83,85,97,101,110,132,133,134,1 35,136,137,138,141,181,183,185,186,188,199,200,201 ,203 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P49841-1_P49841-1_4nm3_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P49841-1_4nm3_A_P49841-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P49841-1_P49841-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P49841-1_vs_P49841-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P49841-1_vs_P49841-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to GSK3B |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P49841 | GSK3B | DB01793 | SB-409513 | experimental | |
| P49841 | GSK3B | DB14507 | Lithium citrate | approved | |
| P49841 | GSK3B | DB14508 | Lithium succinate | experimental | |
| P49841 | GSK3B | DB14509 | Lithium carbonate | approved | |
| P49841 | GSK3B | DB07859 | 4-(4-CHLOROPHENYL)-4-[4-(1H-PYRAZOL-4-YL)PHENYL]PIPERIDINE | experimental | |
| P49841 | GSK3B | DB08073 | (2S)-1-(1H-INDOL-3-YL)-3-{[5-(3-METHYL-1H-INDAZOL-5-YL)PYRIDIN-3-YL]OXY}PROPAN-2-AMINE | experimental | |
| P49841 | GSK3B | DB07149 | (7S)-2-(2-aminopyrimidin-4-yl)-7-(2-fluoroethyl)-1,5,6,7-tetrahydro-4H-pyrrolo[3,2-c]pyridin-4-one | experimental | |
| P49841 | GSK3B | DB07014 | 2-(1,3-benzodioxol-5-yl)-5-[(3-fluoro-4-methoxybenzyl)sulfanyl]-1,3,4-oxadiazole | experimental | |
| P49841 | GSK3B | DB01772 | 3-[3-(2,3-Dihydroxy-Propylamino)-Phenyl]-4-(5-Fluoro-1-Methyl-1h-Indol-3-Yl)-Pyrrole-2,5-Dione | experimental | |
| P49841 | GSK3B | DB04395 | Phosphoaminophosphonic Acid-Adenylate Ester | experimental | |
| P49841 | GSK3B | DB04014 | Alsterpaullone | experimental | |
| P49841 | GSK3B | DB07585 | 5-(5-chloro-7H-pyrrolo[2,3-d]pyrimidin-4-yl)-4,5,6,7-tetrahydro-1H-imidazo[4,5-c]pyridine | experimental | |
| P49841 | GSK3B | DB02052 | Indirubin-3'-monoxime | experimental | |
| P49841 | GSK3B | DB12010 | Fostamatinib | approved, investigational | inhibitor |
| P49841 | GSK3B | DB01356 | Lithium cation | experimental | inhibitor |
| P49841 | GSK3B | DB02010 | Staurosporine | experimental | |
| P49841 | GSK3B | DB07947 | ISOQUINOLINE-5-SULFONIC ACID (2-(2-(4-CHLOROBENZYLOXY)ETHYLAMINO)ETHYL)AMIDE | experimental | |
| P49841 | GSK3B | DB12129 | Tideglusib | investigational, withdrawn | antagonist |
| P49841 | GSK3B | DB07812 | N-[(1S)-2-amino-1-phenylethyl]-5-(1H-pyrrolo[2,3-b]pyridin-4-yl)thiophene-2-carboxamide | experimental | |
| P49841 | GSK3B | DB01950 | AR-AO-14418 | experimental | |
| P49841 | GSK3B | DB07058 | 5-[1-(4-methoxyphenyl)-1H-benzimidazol-6-yl]-1,3,4-oxadiazole-2(3H)-thione | experimental | |
| P49841 | GSK3B | DB07584 | N-[2-(5-methyl-4H-1,2,4-triazol-3-yl)phenyl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine | experimental | |
| P49841 | GSK3B | DB07676 | 3-({[(3S)-3,4-dihydroxybutyl]oxy}amino)-1H,2'H-2,3'-biindol-2'-one | experimental | |
| P49841 | GSK3B | DB03444 | 6-bromoindirubin-3'-oxime | experimental |
Related Diseases to GSK3B |
| Previous studies relating to the alternative splicing of GSK3B and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| GSK3B | 18991351 | Glycogen synthase kinase-3beta and tau genes interact in Alzheimer's disease. | We examined the epistatic effect between haplotypes of glycogen synthase kinase-3beta (GSK3B) gene and microtubule-associated protein Tau (MAPT) gene in Alzheimer's disease (AD). | D000544 | Alzheimer Disease |
| GSK3B | 18991351 | Glycogen synthase kinase-3beta and tau genes interact in Alzheimer's disease. | We examined the epistatic effect between haplotypes of glycogen synthase kinase-3beta (GSK3B) gene and microtubule-associated protein Tau (MAPT) gene in Alzheimer's disease (AD). | D020022 | Genetic Predisposition to Disease |
Clinically important variants in GSK3B |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |