ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:CD209

Protein Summary

Gene summary

Gene name: CD209
ASpdb.0 ID: 30835
	Gene
Gene symbol	CD209
Gene ID	30835
Gene name	CD209 molecule
Synonyms	CDSIGN\|CLEC4L\|DC-SIGN\|DC-SIGN1\|hDC-SIGN
Cytomap	19p13.2
Type of gene	protein-coding
Description	CD209 antigenC-type lectin domain family 4 member LHIV gpl20-binding proteindendritic cell-specific ICAM-3-grabbing non-integrin 1dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrindendritic cell-specific intracellular adh
Modification date	20240305
UniProtAcc	Q9NNX6

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	CD209	GO:0001618	virus receptor activity	22156524\|24623090
Gene	CD209	GO:0005886	plasma membrane	12421943
Gene	CD209	GO:0009897	external side of plasma membrane	24942581
Gene	CD209	GO:0042102	positive regulation of T cell proliferation	12421943
Gene	CD209	GO:0042129	regulation of T cell proliferation	12456590
Gene	CD209	GO:0046718	symbiont entry into host cell	24623090
Gene	CD209	GO:0097323	B cell adhesion	12421943

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
Q9NNX6-1	Q9NNX6-1_6ghv_C.pdb	6GHV	X-ray	2.1	C	252	384

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-10	404	380	1	15	Substitution	MSDSKEPRLQQLGLL	MASACPGSDFTSIHS	1	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-10	404	380	36	59	Deletion	none	none	35	35
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-11	404	334	1	15	Substitution	MSDSKEPRLQQLGLL	MASACPGSDFTSIHS	1	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-11	404	334	36	59	Deletion	none	none	35	35
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-11	404	334	191	236	Deletion	none	none	166	166
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-12	404	297	1	15	Substitution	MSDSKEPRLQQLGLL	MASACPGSDFTSIHS	1	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-12	404	297	36	59	Deletion	none	none	35	35
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-12	404	297	301	321	Substitution	NFLQLQSSRSNRFTWMGLSDL	LQAVLEQRRAQQRWGGRLRGI	277	297
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-12	404	297	322	404	Deletion	none	none	297	297
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-2	404	398	301	306	Deletion	none	none	300	300
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-3	404	312	158	249	Deletion	none	none	157	157
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-4	404	168	74	309	Deletion	none	none	73	73
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-5	404	404	1	15	Substitution	MSDSKEPRLQQLGLL	MASACPGSDFTSIHS	1	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-6	404	380	36	59	Deletion	none	none	35	35
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-7	404	360	16	59	Deletion	none	none	15	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-8	404	268	16	59	Deletion	none	none	15	15
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-8	404	268	142	233	Deletion	none	none	97	97
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-9	404	34	30	34	Substitution	GYKSL	RNQKC	30	34
Q9NNX6	CD209	Q9NNX6-1	Q9NNX6-9	404	34	35	404	Deletion	none	none	34	34

Multiple sequence alignment of our canonical and alternatively spliced CD209

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CD209

UniProt-id	ENSG	ENST	ENSP
Q9NNX6-1	ENSG00000090659.18	ENST00000315599.12	ENSP00000315477.6
Q9NNX6-10	ENSG00000090659.18	ENST00000601951.5	ENSP00000468827.1
Q9NNX6-12	ENSG00000090659.18	ENST00000601256.1	ENSP00000470658.1
Q9NNX6-2	ENSG00000090659.18	ENST00000354397.10	ENSP00000346373.5
Q9NNX6-3	ENSG00000090659.18	ENST00000602261.5	ENSP00000471137.1
Q9NNX6-4	ENSG00000090659.18	ENST00000394161.9	ENSP00000377716.4
Q9NNX6-6	ENSG00000090659.18	ENST00000315591.12	ENSP00000315407.7
Q9NNX6-7	ENSG00000090659.18	ENST00000204801.12	ENSP00000204801.7

UniProt-id	NM ID	NP ID
Q9NNX6-1	NM_021155.3	NP_066978.1
Q9NNX6-2	NM_001144897.1	NP_001138369.1
Q9NNX6-3	NM_001144895.1	NP_001138367.1
Q9NNX6-6	NM_001144896.1	NP_001138368.1
Q9NNX6-7	NM_001144894.1	NP_001138366.1

Amino acid sequences of our canonical and alternatively spliced CD209

accession_id	Protein sequence
Q9NNX6-1	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGE LSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFM SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS
Q9NNX6-10	MASACPGSDFTSIHSEEEQLRGLGFRQTRGYKSLAVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGEL PEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVG ELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVI KSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASC
Q9NNX6-11	MASACPGSDFTSIHSEEEQLRGLGFRQTRGYKSLAVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGEL PEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVE RLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFK
Q9NNX6-12	MASACPGSDFTSIHSEEEQLRGLGFRQTRGYKSLAVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGEL PEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVG ELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVI
Q9NNX6-2	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGE LSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFM SNSQRNWHDSITACKEVGAQLVVIKSAEEQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWND
Q9NNX6-3	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGE LSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVERLCHPCPWEWTFFQGNCYFMSN SQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGN
Q9NNX6-4	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRSNRFTWMGLSDLNQEGT
Q9NNX6-5	MASACPGSDFTSIHSEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGE LSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAV GELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFM SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFS
Q9NNX6-6	MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGEL PEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVG ELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVI KSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASC
Q9NNX6-7	MSDSKEPRLQQLGLLVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAV GELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKA AVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFT WMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Q9NNX6-8	MSDSKEPRLQQLGLLVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAV GELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM
Q9NNX6-9

Protein Functional Features

Main function of this protein. (from UniProt)

CD209 (go to UniProt):Q9NNX6

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=1;End=15
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=1;End=15
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=1;End=15
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=1;End=15
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=30;End=34
Q9NNX6	Topological domain	1	37	Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=35;End=404
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Transmembrane	38	58	Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=35;End=404
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=191;End=236
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Substitution;Start=301;End=321
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=322;End=404
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=301;End=306
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=158;End=249
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=74;End=309
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=36;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=16;End=59
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=142;End=233
Q9NNX6	Topological domain	59	404	Note=Extracellular;Ontology_term=ECO:0000305;evidence=ECO:0000305	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	96	118	Note=1	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	96	118	Note=1	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	119	141	Note=2	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	119	141	Note=2	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	142	164	Note=3	Type=Deletion;Start=158;End=249
Q9NNX6	Repeat	142	164	Note=3	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	142	164	Note=3	Type=Deletion;Start=142;End=233
Q9NNX6	Repeat	142	164	Note=3	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	165	187	Note=4	Type=Deletion;Start=158;End=249
Q9NNX6	Repeat	165	187	Note=4	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	165	187	Note=4	Type=Deletion;Start=142;End=233
Q9NNX6	Repeat	165	187	Note=4	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	188	210	Note=5	Type=Deletion;Start=191;End=236
Q9NNX6	Repeat	188	210	Note=5	Type=Deletion;Start=158;End=249
Q9NNX6	Repeat	188	210	Note=5	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	188	210	Note=5	Type=Deletion;Start=142;End=233
Q9NNX6	Repeat	188	210	Note=5	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	211	233	Note=6	Type=Deletion;Start=191;End=236
Q9NNX6	Repeat	211	233	Note=6	Type=Deletion;Start=158;End=249
Q9NNX6	Repeat	211	233	Note=6	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	211	233	Note=6	Type=Deletion;Start=142;End=233
Q9NNX6	Repeat	211	233	Note=6	Type=Deletion;Start=35;End=404
Q9NNX6	Repeat	234	257	Note=7	Type=Deletion;Start=191;End=236
Q9NNX6	Repeat	234	257	Note=7	Type=Deletion;Start=158;End=249
Q9NNX6	Repeat	234	257	Note=7	Type=Deletion;Start=74;End=309
Q9NNX6	Repeat	234	257	Note=7	Type=Deletion;Start=35;End=404
Q9NNX6	Domain	263	378	Note=C-type lectin;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00040	Type=Substitution;Start=301;End=321
Q9NNX6	Domain	263	378	Note=C-type lectin;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00040	Type=Deletion;Start=322;End=404
Q9NNX6	Domain	263	378	Note=C-type lectin;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00040	Type=Deletion;Start=301;End=306
Q9NNX6	Domain	263	378	Note=C-type lectin;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00040	Type=Deletion;Start=74;End=309
Q9NNX6	Domain	263	378	Note=C-type lectin;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00040	Type=Deletion;Start=35;End=404
Q9NNX6	Region	96	257	Note=7 X approximate tandem repeats	Type=Deletion;Start=191;End=236
Q9NNX6	Region	96	257	Note=7 X approximate tandem repeats	Type=Deletion;Start=158;End=249
Q9NNX6	Region	96	257	Note=7 X approximate tandem repeats	Type=Deletion;Start=74;End=309
Q9NNX6	Region	96	257	Note=7 X approximate tandem repeats	Type=Deletion;Start=142;End=233
Q9NNX6	Region	96	257	Note=7 X approximate tandem repeats	Type=Deletion;Start=35;End=404
Q9NNX6	Motif	14	15	Note=Endocytosis signal	Type=Substitution;Start=1;End=15
Q9NNX6	Motif	14	15	Note=Endocytosis signal	Type=Substitution;Start=1;End=15
Q9NNX6	Motif	14	15	Note=Endocytosis signal	Type=Substitution;Start=1;End=15
Q9NNX6	Motif	14	15	Note=Endocytosis signal	Type=Substitution;Start=1;End=15
Q9NNX6	Motif	16	18	Note=Endocytosis signal;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=16;End=59
Q9NNX6	Motif	16	18	Note=Endocytosis signal;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=16;End=59
Q9NNX6	Motif	31	34	Note=Endocytosis signal;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=16;End=59
Q9NNX6	Motif	31	34	Note=Endocytosis signal;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=16;End=59
Q9NNX6	Motif	31	34	Note=Endocytosis signal;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=30;End=34

Gene Isoform Structures and Expression Levels for CD209

Gene structures of our canonical and alternative spliced genes of CD209
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of Q9NNX6-1

3D view using mol* of Q9NNX6-10

3D view using mol* of Q9NNX6-11

3D view using mol* of Q9NNX6-12

3D view using mol* of Q9NNX6-2

3D view using mol* of Q9NNX6-3

3D view using mol* of Q9NNX6-4

3D view using mol* of Q9NNX6-5

3D view using mol* of Q9NNX6-6

3D view using mol* of Q9NNX6-7

3D view using mol* of Q9NNX6-8

3D view using mol* of Q9NNX6-9

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of Q9NNX6-1

pLDDT distribution across the protein length of Q9NNX6-10

pLDDT distribution across the protein length of Q9NNX6-11

pLDDT distribution across the protein length of Q9NNX6-12

pLDDT distribution across the protein length of Q9NNX6-2

pLDDT distribution across the protein length of Q9NNX6-3

pLDDT distribution across the protein length of Q9NNX6-4

pLDDT distribution across the protein length of Q9NNX6-5

pLDDT distribution across the protein length of Q9NNX6-6

pLDDT distribution across the protein length of Q9NNX6-7

pLDDT distribution across the protein length of Q9NNX6-8

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of Q9NNX6-1

Ramachandran plot of Q9NNX6-2

Ramachandran plot of Q9NNX6-3

Ramachandran plot of Q9NNX6-4

Ramachandran plot of Q9NNX6-5

Ramachandran plot of Q9NNX6-6

Ramachandran plot of Q9NNX6-7

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
Q9NNX6-1	1.027	101	1.069	362.894	0.724	0.69	0.807	0.507	0.874	0.58	0.656	124,127,128,131,147,150,151,154,155,158,254,255,25 6,257,258,259,260,261,262,268,269,270,271,272,273, 306,307,310,312,314,374,375,376
Q9NNX6-10	1.026	246	1.068	618.429	0.539	0.689	0.936	0.861	0.874	0.985	0.795	138,140,141,142,182,183,184,185,186,188,189,192,19 3,195,196,199,215,218,219,222,223,226,228,229,230, 232,233,234,360,361,362,363,364,367,368
Q9NNX6-11	1.019	154	1.054	458.591	0.557	0.694	0.906	0.757	0.929	0.814	0.92	28,29,31,32,33,34,49,52,53,56,59,60,62,63,66,67,68 ,69,72,75,76,78,79,82,83,86,89,90
Q9NNX6-12	1.147	94	1.252	198.254	0.495	0.746	0.995	2.672	0.327	8.164	1.409	168,169,172,174,175,176,178,179,182,190,191,194,19 5,198,202,214,217,218,220,221,225
Q9NNX6-2	1.026	218	1.057	620.144	0.578	0.71	0.957	0.653	0.948	0.689	1.172	78,112,113,114,115,116,162,206,207,208,209,212,213 ,216,219,220,223,239,242,243,246,250,252,253,254,2 55,256,257,258,259,260,269,287,373,374,375,376,377 ,378,379,380,381,382,385,386
Q9NNX6-3	1.041	270	1.073	527.877	0.448	0.727	0.993	0.82	0.93	0.882	0.728	70,74,114,115,116,117,120,121,124,125,127,128,131, 132,135,147,150,154,158,160,161,162,163,164,165,16 6,287,288,289,290,291,292,293,294,295,296,299,300
Q9NNX6-4	0.885	79	0.881	188.307	0.503	0.647	0.974	0.447	1.052	0.425	0.786	71,72,73,74,75,76,77,78,123,124,125,138,140
Q9NNX6-5	1.041	423	1.083	1329.125	0.596	0.707	0.898	0.757	0.862	0.878	1.016	66,67,69,70,71,73,74,76,77,80,83,84,87,114,115,116 ,117,120,145,146,148,149,151,152,154,155,156,158,1 59,160,161,162,163,164,165,166,206,251,252,253,254 ,255,256,257,258,259,260,261,262,263,264,268,269,2 70,271,272,298,300,301,302,304,305,306,307,308,309 ,310,312,314,342,362,363,374,375,376
Q9NNX6-6	1.016	182	1.059	371.126	0.516	0.673	0.919	0.803	0.872	0.921	1.221	185,186,188,189,192,193,195,199,215,218,219,222,22 6,227,229,359,360,361,362,363,364,365,367,368,369, 370,371
Q9NNX6-7	1.056	114	1.085	288.806	0.535	0.755	1.096	1.04	0.945	1.101	0.959	169,172,173,175,176,179,195,198,199,202,206,209,34 0,341,342,343,344,347,348
Q9NNX6-8	1.051	107	1.077	190.365	0.409	0.753	1.075	1.133	0.966	1.173	1.067	26,30,70,71,72,73,76,80,116,117,118,119,120,121,12 2,243,244,245,246,247,248,250

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of Q9NNX6-1_Q9NNX6-1_6ghv_C.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-10.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-11.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-12.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-2.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-3.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-4.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-5.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-6.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-7.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-8.pdb

3D view using mol* of Q9NNX6-1_6ghv_C_Q9NNX6-9.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q9NNX6-1_Q9NNX6-10.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-11.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-12.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-2.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-3.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-4.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-5.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-6.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-7.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-8.pdb

3D view using mol* of Q9NNX6-1_Q9NNX6-9.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-10.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-11.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-12.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-2.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-3.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-4.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-5.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-6.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-7.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-8.png

./stats/secondary_structure/figure/Q9NNX6-1_vs_Q9NNX6-9.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-10.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-11.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-12.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-2.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-3.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-4.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-5.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-6.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-7.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-8.png

./stats/relative_asa/Q9NNX6-1_vs_Q9NNX6-9.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id

Subsection

Start

End

Funcitonal feature

Splicing information

Interactors from STRING.

Gene name

Interactors

Related Drugs to CD209

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession

Gene name

DrugBank ID

Drug name

Drug group

Actions

Related Diseases to CD209

Previous studies relating to the alternative splicing of CD209 and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
CD209	14603101	DC-SIGN points the way to a novel mechanism for HIV-1 transmission.	"Dendritic cell (DC)-specific intercellular adhesion molecule 3 (ICAM-3) grabbing nonintegrin (DC-SIGN), a recently discovered type II transmembrane protein on DCs with a C-type lectin extracellular domain, is capable of binding ICAM-3 on resting T cells in the secondary lymphoid organs, providing the initial contact between these cells during the establishment of cell-mediated immunity. DC-SIGN also binds the HIV-1 envelope glycoprotein gp120 but does not function as a receptor for viral entry into DCs. Instead, DC-SIGN allows DCs in the peripheral mucosa to carry HIV-1 through the lymphatics in a ""Trojan horse"" fashion, where it is eventually delivered to the T cells. Also, the period of infectivity of HIV-1 is increased by several days as a result of DC-SIGN-gp120 binding, allowing for efficient trans-infection of T cells on DC arrival. The discovery of a cluster of related genes colocalized with DC-SIGN on chromosome 19p13.2-3, all displaying complex alternative splicing patterns, has led to a reexamination of the mechanisms underlying both the interactions between antigen-presenting cells (APCs) and T cells and the pathogenesis of HIV-1 infection."	D015658	HIV Infections

Clinically important variants in CD209

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance