Protein:IRF5 |
Protein Summary |
 Gene summary |
| Gene name: IRF5 | ASpdb.0 ID: 3663 | Gene | Gene symbol | IRF5 | Gene ID | 3663 |
| Gene name | interferon regulatory factor 5 |
| Synonyms | SLEB10 |
| Cytomap | 7q32.1 |
| Type of gene | protein-coding |
| Description | interferon regulatory factor 5 |
| Modification date | 20240403 |
| UniProtAcc | Q13568 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | IRF5 | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific | 25326418 |
| Gene | IRF5 | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific | 12600985 |
| Gene | IRF5 | GO:0002720 | positive regulation of cytokine production involved in immune response | 29046356 |
| Gene | IRF5 | GO:0005634 | nucleus | 22412986|25326418 |
| Gene | IRF5 | GO:0005737 | cytoplasm | 22412986|25326418 |
| Gene | IRF5 | GO:0019221 | cytokine-mediated signaling pathway | 25326418 |
| Gene | IRF5 | GO:0032481 | positive regulation of type I interferon production | 32433612 |
| Gene | IRF5 | GO:0032494 | response to peptidoglycan | 22412986 |
| Gene | IRF5 | GO:0032495 | response to muramyl dipeptide | 22412986 |
| Gene | IRF5 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 12600985|22412986|25326418|32433612 |
| Gene | IRF5 | GO:0098586 | cellular response to virus | 29046356 |
| Gene | IRF5 | GO:1990837 | sequence-specific double-stranded DNA binding | 28473536 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q13568-1 | Q13568-1_3dsh_A.pdb | 3DSH | X-ray | 2.0 | A | 232 | 467 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q13568 | IRF5 | Q13568-1 | Q13568-2 | 498 | 514 | 160 | 160 | Substitution | T | TDAVQSGPHMTPYSLLK | 160 | 176 |
| Q13568 | IRF5 | Q13568-1 | Q13568-3 | 498 | 504 | 161 | 175 | Substitution | EDVKWPPTLQPPTLR | DAVQSGPHMTPYSLLKEDVKW | 161 | 181 |
| Q13568 | IRF5 | Q13568-1 | Q13568-4 | 498 | 488 | 166 | 175 | Deletion | none | none | 165 | 165 |
| Q13568 | IRF5 | Q13568-1 | Q13568-5 | 498 | 412 | 161 | 247 | Substitution | EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL | V | 161 | 161 |
| Q13568 | IRF5 | Q13568-1 | Q13568-6 | 498 | 147 | 120 | 147 | Substitution | VCSNGPAPTDSQPPEDYSFGAGEEEEEE | TPSPLRITLLVQERRRKKRKSCRGCCQA | 120 | 147 |
| Q13568 | IRF5 | Q13568-1 | Q13568-6 | 498 | 147 | 148 | 498 | Deletion | none | none | 147 | 147 |
| Multiple sequence alignment of our canonical and alternatively spliced IRF5 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of IRF5 |
| UniProt-id | ENSG | ENST | ENSP |
| Q13568-1 | ENSG00000128604.21 | ENST00000402030.6 | ENSP00000385352.2 |
| Q13568-1 | ENSG00000128604.21 | ENST00000473745.5 | ENSP00000419149.1 |
| Q13568-2 | ENSG00000128604.21 | ENST00000357234.10 | ENSP00000349770.5 |
| Q13568-2 | ENSG00000128604.21 | ENST00000489702.6 | ENSP00000418037.2 |
| Q13568-5 | ENSG00000128604.21 | ENST00000477535.5 | ENSP00000419950.1 |
| Q13568-6 | ENSG00000128604.21 | ENST00000465603.5 | ENSP00000418534.1 |
| UniProt-id | NM ID | NP ID |
| Q13568-1 | NM_001098627.3 | NP_001092097.2 |
| Q13568-1 | NM_001098630.2 | NP_001092100.1 |
| Q13568-1 | NM_032643.4 | NP_116032.1 |
| Q13568-2 | NM_001098629.2 | NP_001092099.1 |
| Q13568-2 | NM_001347928.1 | NP_001334857.1 |
| Q13568-2 | XM_006715974.2 | XP_006716037.1 |
| Q13568-2 | XM_011516158.2 | XP_011514460.1 |
| Q13568-2 | XM_011516159.2 | XP_011514461.1 |
| Q13568-2 | XM_011516160.1 | XP_011514462.1 |
| Q13568-5 | NM_001242452.2 | NP_001229381.1 |
| Amino acid sequences of our canonical and alternatively spliced IRF5 |
| accession_id | Protein sequence |
| Q13568-1 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL RCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQ PPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPH GCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL |
| Q13568-2 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL RCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTDAVQSGPHMTPYSLLKEDVK WPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKF QYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKV FWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGEL |
| Q13568-3 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL RCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTDAVQSGPHMTPYSLLKEDVK WPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRAL TISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAH DSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQ |
| Q13568-4 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL RCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLQPPVVL GPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLF SLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE |
| Q13568-5 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL RCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTVTDLEIKFQYRGRPPRALTI SNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDS CPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQIS |
| Q13568-6 | MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| IRF5 (go to UniProt):Q13568 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q13568 | DNA binding | 14 | 122 | Note=IRF tryptophan pentad repeat;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00840 | Type=Substitution;Start=120;End=147 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=160;End=160 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=161;End=175 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=166;End=175 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=161;End=247 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=120;End=147 |
| Q13568 | Region | 121 | 207 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=148;End=498 |
| Q13568 | Region | 478 | 498 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=148;End=498 |
| Q13568 | Motif | 150 | 160 | Note=Nuclear export signal;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15556946;Dbxref=PMID:15556946 | Type=Substitution;Start=160;End=160 |
| Q13568 | Motif | 150 | 160 | Note=Nuclear export signal;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15556946;Dbxref=PMID:15556946 | Type=Deletion;Start=148;End=498 |
| Q13568 | Compositional bias | 169 | 206 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=161;End=175 |
| Q13568 | Compositional bias | 169 | 206 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=166;End=175 |
| Q13568 | Compositional bias | 169 | 206 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=161;End=247 |
| Q13568 | Compositional bias | 169 | 206 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=148;End=498 |
Gene Isoform Structures and Expression Levels for IRF5 |
| Gene structures of our canonical and alternative spliced genes of IRF5 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q13568-1 |
| 3D view using mol* of Q13568-2 |
| 3D view using mol* of Q13568-3 |
| 3D view using mol* of Q13568-4 |
| 3D view using mol* of Q13568-5 |
| 3D view using mol* of Q13568-6 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q13568-1 |
 |
| pLDDT distribution across the protein length of Q13568-2 |
 |
| pLDDT distribution across the protein length of Q13568-3 |
 |
| pLDDT distribution across the protein length of Q13568-4 |
 |
| pLDDT distribution across the protein length of Q13568-5 |
 |
| pLDDT distribution across the protein length of Q13568-6 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q13568-1 |
 |
| Ramachandran plot of Q13568-2 |
 |
| Ramachandran plot of Q13568-5 |
 |
| Ramachandran plot of Q13568-6 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q13568-1 | 1.009 | 141 | 1.053 | 381.416 | 0.561 | 0.665 | 0.87 | 0.777 | 0.879 | 0.884 | 1.185 | 30,31,32,33,46,48,49,50,53,54,55,56,58,59,60,61,62 ,63,64,65,83,86,87,107,111,113,114,115 |
| Q13568-2 | 1.039 | 97 | 0.979 | 267.883 | 0.461 | 0.772 | 1.075 | 0.859 | 1.257 | 0.683 | 0.992 | 146,149,150,153,154,156,157,273,329,333,336,357,35 8,359,361,416,417,418,421,423,427,428,429 |
| Q13568-3 | 1.068 | 112 | 1.149 | 387.59 | 0.596 | 0.671 | 0.847 | 1.162 | 0.594 | 1.956 | 3.203 | 241,243,244,245,246,247,248,250,251,252,389,431,43 5,436,440,441,442,443,444,446,447,448 |
| Q13568-4 | 1.092 | 94 | 1.177 | 225.694 | 0.484 | 0.714 | 0.928 | 1.762 | 0.501 | 3.519 | 3.024 | 227,228,231,234,235,236,415,419,424,425,426,427,42 8,430,431,432 |
| Q13568-5 | 1.023 | 141 | 1.011 | 347.116 | 0.478 | 0.732 | 0.993 | 0.634 | 1.13 | 0.561 | 0.924 | 30,31,32,33,45,46,48,49,50,53,54,55,56,57,58,59,60 ,61,62,63,64,65,83,86,87,113,115 |
| Q13568-6 | 1.007 | 188 | 1.01 | 391.02 | 0.47 | 0.709 | 0.959 | 0.635 | 1.089 | 0.583 | 0.685 | 30,31,32,34,44,46,48,49,50,52,53,54,56,57,58,59,60 ,61,62,63,64,65,83,86,87,108,109,111,112,113,114,1 15 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q13568-1_Q13568-1_3dsh_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q13568-1_3dsh_A_Q13568-2.pdb |
| 3D view using mol* of Q13568-1_3dsh_A_Q13568-3.pdb |
| 3D view using mol* of Q13568-1_3dsh_A_Q13568-4.pdb |
| 3D view using mol* of Q13568-1_3dsh_A_Q13568-5.pdb |
| 3D view using mol* of Q13568-1_3dsh_A_Q13568-6.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q13568-1_Q13568-2.pdb |
| 3D view using mol* of Q13568-1_Q13568-3.pdb |
| 3D view using mol* of Q13568-1_Q13568-4.pdb |
| 3D view using mol* of Q13568-1_Q13568-5.pdb |
| 3D view using mol* of Q13568-1_Q13568-6.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q13568-1_vs_Q13568-2.png |
 < |
| ./stats/secondary_structure/figure/Q13568-1_vs_Q13568-3.png |
 < |
| ./stats/secondary_structure/figure/Q13568-1_vs_Q13568-4.png |
 < |
| ./stats/secondary_structure/figure/Q13568-1_vs_Q13568-5.png |
 < |
| ./stats/secondary_structure/figure/Q13568-1_vs_Q13568-6.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q13568-1_vs_Q13568-2.png |
 < |
| ./stats/relative_asa/Q13568-1_vs_Q13568-3.png |
 < |
| ./stats/relative_asa/Q13568-1_vs_Q13568-4.png |
 < |
| ./stats/relative_asa/Q13568-1_vs_Q13568-5.png |
 < |
| ./stats/relative_asa/Q13568-1_vs_Q13568-6.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to IRF5 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to IRF5 |
| Previous studies relating to the alternative splicing of IRF5 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| IRF5 | 20112383 | Genetic variants and disease-associated factors contribute to enhanced interferon regulatory factor 5 expression in blood cells of patients with systemic lupus erythematosus. | Genetic variants of the interferon (IFN) regulatory factor 5 gene (IRF5) are associated with susceptibility to systemic lupus erythematosus (SLE). The contribution of these variants to IRF-5 expression in primary blood cells of SLE patients has not been addressed, nor has the role of type I IFNs. The aim of this study was to determine the association between increased IRF-5 expression and the IRF5 risk haplotype in SLE patients. | D020022 | Genetic Predisposition to Disease |
| IRF5 | 20112383 | Genetic variants and disease-associated factors contribute to enhanced interferon regulatory factor 5 expression in blood cells of patients with systemic lupus erythematosus. | Genetic variants of the interferon (IFN) regulatory factor 5 gene (IRF5) are associated with susceptibility to systemic lupus erythematosus (SLE). The contribution of these variants to IRF-5 expression in primary blood cells of SLE patients has not been addressed, nor has the role of type I IFNs. The aim of this study was to determine the association between increased IRF-5 expression and the IRF5 risk haplotype in SLE patients. | D008180 | Lupus Erythematosus, Systemic |
| IRF5 | 23349905 | RNA-Seq for enrichment and analysis of IRF5 transcript expression in SLE. | Polymorphisms in the interferon regulatory factor 5 (IRF5) gene have been consistently replicated and shown to confer risk for or protection from the development of systemic lupus erythematosus (SLE). IRF5 expression is significantly upregulated in SLE patients and upregulation associates with IRF5-SLE risk haplotypes. IRF5 alternative splicing has also been shown to be elevated in SLE patients. Given that human IRF5 exists as multiple alternatively spliced transcripts with distinct function(s), it is important to determine whether the IRF5 transcript profile expressed in healthy donor immune cells is different from that expressed in SLE patients. Moreover, it is not currently known whether an IRF5-SLE risk haplotype defines the profile of IRF5 transcripts expressed. Using standard molecular cloning techniques, we identified and isolated 14 new differentially spliced IRF5 transcript variants from purified monocytes of healthy donors and SLE patients to generate an IRF5 variant transcriptome. Next-generation sequencing was then used to perform in-depth and quantitative analysis of full-length IRF5 transcript expression in primary immune cells of SLE patients and healthy donors by next-generation sequencing. Evidence for additional alternatively spliced transcripts was obtained from de novo junction discovery. Data from these studies support the overall complexity of IRF5 alternative splicing in SLE. Results from next-generation sequencing correlated with cloning and gave similar abundance rankings in SLE patients thus supporting the use of this new technology for in-depth single gene transcript profiling. Results from this study provide the first proof that 1) SLE patients express an IRF5 transcript signature that is distinct from healthy donors, 2) an IRF5-SLE risk haplotype defines the top four most abundant IRF5 transcripts expressed in SLE patients, and 3) an IRF5 transcript signature enables clustering of SLE patients with the H2 risk haplotype. | D008180 | Lupus Erythematosus, Systemic |
Clinically important variants in IRF5 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |