Protein:IRF7 |
Protein Summary |
Gene summary |
| Gene name: IRF7 | ASpdb.0 ID: 3665 | Gene | Gene symbol | IRF7 | Gene ID | 3665 |
| Gene name | interferon regulatory factor 7 |
| Synonyms | IMD39|IRF-7|IRF-7H|IRF7A|IRF7B|IRF7C|IRF7H |
| Cytomap | 11p15.5 |
| Type of gene | protein-coding |
| Description | interferon regulatory factor 7interferon regulatory factor-7H |
| Modification date | 20240403 |
| UniProtAcc | Q92985 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | IRF7 | GO:0000785 | chromatin | 11473119 |
| Gene | IRF7 | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 17404045 |
| Gene | IRF7 | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific | 17404045 |
| Gene | IRF7 | GO:0002753 | cytoplasmic pattern recognition receptor signaling pathway | 21931555 |
| Gene | IRF7 | GO:0002819 | regulation of adaptive immune response | 17404045 |
| Gene | IRF7 | GO:0005634 | nucleus | 22065573 |
| Gene | IRF7 | GO:0005654 | nucleoplasm | - |
| Gene | IRF7 | GO:0005737 | cytoplasm | 19176627 |
| Gene | IRF7 | GO:0005829 | cytosol | - |
| Gene | IRF7 | GO:0032481 | positive regulation of type I interferon production | 17404045 |
| Gene | IRF7 | GO:0032727 | positive regulation of interferon-alpha production | 16127453 |
| Gene | IRF7 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 16127453|17404045 |
| Gene | IRF7 | GO:0051607 | defense response to virus | 21478870 |
| Gene | IRF7 | GO:1990837 | sequence-specific double-stranded DNA binding | 28473536 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q92985-1 | Q92985-1_2o61_A.pdb | 2O61 | X-ray | 2.8 | A | 20 | 125 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q92985 | IRF7 | Q92985-1 | Q92985-2 | 503 | 474 | 228 | 256 | Deletion | none | none | 227 | 227 |
| Q92985 | IRF7 | Q92985-1 | Q92985-3 | 503 | 164 | 152 | 164 | Substitution | GGPPGPFLAHTHA | AQGSLLGSCTGGQ | 152 | 164 |
| Q92985 | IRF7 | Q92985-1 | Q92985-3 | 503 | 164 | 165 | 503 | Deletion | none | none | 164 | 164 |
| Q92985 | IRF7 | Q92985-1 | Q92985-4 | 503 | 516 | 1 | 6 | Substitution | MALAPE | MPVPERPAAGPDSPRPGTR | 1 | 19 |
Multiple sequence alignment of our canonical and alternatively spliced IRF7 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of IRF7 |
| UniProt-id | ENSG | ENST | ENSP |
| Q92985-1 | ENSG00000185507.21 | ENST00000525445.6 | ENSP00000434009.2 |
| Q92985-1 | ENSG00000276561.4 | ENST00000621391.4 | ENSP00000480358.1 |
| Q92985-2 | ENSG00000185507.21 | ENST00000348655.11 | ENSP00000331803.9 |
| Q92985-2 | ENSG00000276561.4 | ENST00000633943.1 | ENSP00000488666.1 |
| Q92985-3 | ENSG00000185507.21 | ENST00000469048.6 | ENSP00000434607.1 |
| Q92985-3 | ENSG00000185507.21 | ENST00000533182.5 | ENSP00000433903.1 |
| Q92985-3 | ENSG00000276561.4 | ENST00000633274.1 | ENSP00000488591.1 |
| Q92985-3 | ENSG00000276561.4 | ENST00000634105.1 | ENSP00000488581.1 |
| Q92985-4 | ENSG00000185507.21 | ENST00000330243.9 | ENSP00000329411.5 |
| Q92985-4 | ENSG00000185507.21 | ENST00000397566.5 | ENSP00000380697.1 |
| Q92985-4 | ENSG00000276561.4 | ENST00000612534.4 | ENSP00000479615.1 |
| Q92985-4 | ENSG00000276561.4 | ENST00000632827.1 | ENSP00000488039.1 |
| UniProt-id | NM ID | NP ID |
| Q92985-1 | NM_001572.3 | NP_001563.2 |
| Q92985-2 | NM_004029.2 | NP_004020.1 |
| Q92985-4 | NM_004031.2 | NP_004022.2 |
Amino acid sequences of our canonical and alternatively spliced IRF7 |
| accession_id | Protein sequence |
| Q92985-1 | MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAG WKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPY LSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVL |
| Q92985-2 | MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAG WKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRT VLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASP STPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLS |
| Q92985-3 | MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAG |
| Q92985-4 | MPVPERPAAGPDSPRPGTRRAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGG GPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQ APGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGE AAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTE ELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQD |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| IRF7 (go to UniProt):Q92985 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q92985 | Region | 133 | 156 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=152;End=164 |
| Q92985 | Region | 242 | 277 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=228;End=256 |
| Q92985 | Region | 242 | 277 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=165;End=503 |
| Q92985 | Region | 284 | 456 | Note=Necessary for the interaction with NMI;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P70434 | Type=Deletion;Start=165;End=503 |
Gene Isoform Structures and Expression Levels for IRF7 |
Gene structures of our canonical and alternative spliced genes of IRF7* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q92985-1 |
| 3D view using mol* of Q92985-2 |
| 3D view using mol* of Q92985-3 |
| 3D view using mol* of Q92985-4 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q92985-1 |
![]() |
| Ramachandran plot of Q92985-3 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q92985-1 | 1.04 | 139 | 1.093 | 460.306 | 0.594 | 0.687 | 0.856 | 0.905 | 0.793 | 1.141 | 1.56 | 283,286,418,456,457,459,460,461,463,464,465,467,46 8,471,475,477,478,480,481,482,483,484,485,487,488, 491,494,495,498 |
| Q92985-2 | 1.042 | 159 | 1.07 | 623.574 | 0.535 | 0.738 | 1.006 | 0.922 | 0.961 | 0.959 | 0.686 | 15,19,102,103,104,124,127,128,129,130,131,132,182, 185,186,189,190,335,336,349,350,351,362,363,365,37 3,374,375,376,377,379,380,381,382,383,384,386,397, 398 |
| Q92985-3 | 0.792 | 55 | 0.711 | 133.77 | 0.574 | 0.67 | 0.948 | 0.091 | 1.189 | 0.076 | 0.728 | 27,28,29,41,43,44,45,47,55,56,58,59,60,116,117,118 ,119 |
| Q92985-4 | 0.953 | 349 | 0.915 | 829.717 | 0.619 | 0.628 | 0.846 | 0.167 | 1.231 | 0.136 | 0.908 | 21,22,23,24,25,26,27,28,32,36,45,49,50,51,52,76,78 ,79,80,81,82,111,114,115,117,119,136,137,138,139,1 40,141,142,143,144,145,146,390,392,394,395,396,397 ,398,399,401,402,403,404,405,406,407,408,430,433,4 34,435,436,440,444,450,451,452,453,454,455,456,457 ,458,482,483,484,485,486,487 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q92985-1_Q92985-1_2o61_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92985-1_2o61_A_Q92985-2.pdb |
| 3D view using mol* of Q92985-1_2o61_A_Q92985-3.pdb |
| 3D view using mol* of Q92985-1_2o61_A_Q92985-4.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q92985-1_Q92985-2.pdb |
| 3D view using mol* of Q92985-1_Q92985-3.pdb |
| 3D view using mol* of Q92985-1_Q92985-4.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q92985-1_vs_Q92985-2.png |
< |
| ./stats/secondary_structure/figure/Q92985-1_vs_Q92985-3.png |
< |
| ./stats/secondary_structure/figure/Q92985-1_vs_Q92985-4.png |
< |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q92985-1_vs_Q92985-2.png |
< |
| ./stats/relative_asa/Q92985-1_vs_Q92985-3.png |
< |
| ./stats/relative_asa/Q92985-1_vs_Q92985-4.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q92985 | Region | 284 | 456 | Note=Necessary for the interaction with NMI;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:P70434 | Type=Deletion;Start=165;End=503 |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to IRF7 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to IRF7 |
Previous studies relating to the alternative splicing of IRF7 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| IRF7 | 20209099 | Dual functions of interferon regulatory factors 7C in Epstein-Barr virus-mediated transformation of human B lymphocytes. | Epstein-Barr virus (EBV) infection is associated with several human malignancies. Interferon (IFN) regulatory factor 7 (IRF-7) has several splicing variants, and at least the major splicing variant (IRF-7A) has oncogenic potential and is associated with EBV transformation processes. IRF-7C is an alternative splicing variant with only the DNA-binding domain of IRF-7. Whether IRF-7C is present under physiological conditions and its functions in viral transformation are unknown. In this report, we prove the existence of IRF-7C protein and RNA in certain cells under physiological conditions, and find that high levels of IRF-7C are associated with EBV transformation of human primary B cells in vitro as well as EBV type III latency. EBV latent membrane protein 1 (LMP-1) stimulates IRF-7C expression in B lymphocytes. IRF-7C has oncogenic potential in rodent cells and partially restores the growth properties of EBV-transformed cells under a growth-inhibition condition. A tumor array experiment has identified six primary tumor specimens with high levels of IRF-7C protein--all of them are lymphomas. Furthermore, we show that the expression of IRF-7C is apparently closely associated with other IRF-7 splicing variants. IRF-7C inhibits the function of IRF-7 in transcriptional regulation of IFN genes. These data suggest that EBV may use splicing variants of IRF-7 for its transformation process in two strategies: to use oncogenic properties of various IRF-7 splicing variants, but use one of its splicing variants (IRF-7C) to block the IFN-induction function of IRF-7 that is detrimental for viral transformation. The work provides a novel relation of host/virus interactions, and has expanded our knowledge about IRFs in EBV transformation. | D002472 | Cell Transformation, Viral |
Clinically important variants in IRF7 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|