Protein:LGALS8 |
Protein Summary |
 Gene summary |
| Gene name: LGALS8 | ASpdb.0 ID: 3964 | Gene | Gene symbol | LGALS8 | Gene ID | 3964 |
| Gene name | galectin 8 |
| Synonyms | Gal-8|PCTA-1|PCTA1|Po66-CBP |
| Cytomap | 1q43 |
| Type of gene | protein-coding |
| Description | galectin-8Po66 carbohydrate binding proteingalectin-8glectin, galactoside-binding, soluble, 8po66 carbohydrate-binding proteinprostate carcinoma tumor antigen 1 |
| Modification date | 20240403 |
| UniProtAcc | O00214 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | LGALS8 | GO:0005737 | cytoplasm | 19268462 |
| Gene | LGALS8 | GO:0005829 | cytosol | 22246324 |
| Gene | LGALS8 | GO:0030246 | carbohydrate binding | 22246324 |
| Gene | LGALS8 | GO:1904977 | lymphatic endothelial cell migration | 19268462 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| O00214-1 | O00214-1_6z6y_A.pdb | 6Z6Y | X-ray | 1.34 | A | 5 | 160 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| O00214 | LGALS8 | O00214-1 | O00214-2 | 317 | 359 | 183 | 183 | Substitution | L | LPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSK | 183 | 225 |
| Multiple sequence alignment of our canonical and alternatively spliced LGALS8 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of LGALS8 |
| UniProt-id | ENSG | ENST | ENSP |
| O00214-1 | ENSG00000116977.19 | ENST00000341872.10 | ENSP00000342139.6 |
| O00214-1 | ENSG00000116977.19 | ENST00000366584.9 | ENSP00000355543.4 |
| O00214-1 | ENSG00000116977.19 | ENST00000526634.5 | ENSP00000437040.1 |
| O00214-2 | ENSG00000116977.19 | ENST00000352231.6 | ENSP00000309576.2 |
| O00214-2 | ENSG00000116977.19 | ENST00000450372.6 | ENSP00000408657.2 |
| O00214-2 | ENSG00000116977.19 | ENST00000526589.5 | ENSP00000435460.1 |
| O00214-2 | ENSG00000116977.19 | ENST00000527974.5 | ENSP00000431398.1 |
| UniProt-id | NM ID | NP ID |
| O00214-1 | NM_201543.2 | NP_963837.1 |
| O00214-1 | NM_201544.2 | NP_963838.1 |
| O00214-2 | NM_006499.4 | NP_006490.3 |
| O00214-2 | NM_201545.2 | NP_963839.1 |
| Amino acid sequences of our canonical and alternatively spliced LGALS8 |
| accession_id | Protein sequence |
| O00214-1 | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREE ITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMI |
| O00214-2 | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREE ITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT PQLPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIAL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| LGALS8 (go to UniProt):O00214 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for LGALS8 |
| Gene structures of our canonical and alternative spliced genes of LGALS8 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of O00214-1 |
| 3D view using mol* of O00214-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of O00214-1 |
 |
| pLDDT distribution across the protein length of O00214-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of O00214-1 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| O00214-1 | 1.015 | 165 | 1.018 | 400.624 | 0.556 | 0.72 | 0.963 | 0.337 | 1.088 | 0.31 | 0.867 | 2,3,4,5,6,32,104,106,108,115,116,117,118,119,120,1 21,122,123,234,237,256,257,258,259,260,261,262,265 ,268,270,281,282,283,284,285,286,287 |
| O00214-2 | 1.036 | 158 | 1.035 | 314.188 | 0.468 | 0.752 | 1.071 | 0.814 | 1.092 | 0.746 | 0.982 | 2,3,5,104,106,108,115,117,118,119,120,121,122,276, 279,281,298,299,300,301,302,303,304,305,307,308,32 4,325,326,327,328,329 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of O00214-1_O00214-1_6z6y_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O00214-1_6z6y_A_O00214-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O00214-1_O00214-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/O00214-1_vs_O00214-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/O00214-1_vs_O00214-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to LGALS8 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to LGALS8 |
| Previous studies relating to the alternative splicing of LGALS8 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| LGALS8 | 11675018 | Two messenger RNAs and five isoforms for Po66-CBP, a galectin-8 homolog in a human lung carcinoma cell line. | Galectins are animal proteins which specifically bind beta-D-galactoside residues and their specific cellular function is not yet clearly established. However, these proteins seem to play a role in neoplastic transformations. Po66 is a murine monoclonal antibody directed against a protein from human lung carcinoma, Po66 Carbohydrate-Binding-Protein (Po66-CBP), which belongs to the galectin-8 family. Our results show that the Po66-CBP gene generates five transcripts by alternative splicing, which could give rise to five proteins: two proteins belong to the tandemly repeated galectin family and three belong to the single carbohydrate recognition domain galectins. All these proteins are encoded by a unique gene located in 1q42. Experiments carried out by reverse transcriptase-polymerase chain reaction show that the levels of expression of these five galectin-8 isoforms are variable during the culture time in SK-MES-1, a human lung squamous carcinoma cell line. Cancer Genome Anatomy Project database analysis confirms the presence of Po66-CBP in lung cancer and its absence in healthy lung. | D008175 | Lung Neoplasms |
| LGALS8 | 24696431 | Expression, localization and function of galectin-8, a tandem-repeat lectin, in human tumors. | Galectin-8 (Gal-8) is a 'tandem-repeat'-type galectin, which possesses two carbohydrate recognition domains connected by a linker peptide. Gal-8 complexity is related to the alternative splicing of its mRNA precursor, which is known to generate isoforms. Regarding its carbohydrate-binding specificity, Gal-8 has a unique feature among galectins, since its C-terminal domain has higher affinity for N-glycan-type branched oligosaccharides, while its N-terminal domain shows strong affinity for α2-3-sialylated or 3'-sulfated β-galactosides. We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression with the overarching goal of analyzing its potential applications in diagnosis and prognosis. Differential diagnosis is still a prime concern in tumor pathology, and Gal-8 could be of great value in some types of primary or secondary tumors (i.e. papillary thyroid carcinoma, advanced colon carcinoma from patients with distant metastases, or metastases from primary lung carcinoma). The prognostic value of Gal-8 has been described for laryngeal carcinoma as well as advanced colon carcinoma. Further studies are needed to explain the relevance of Gal-8 and its isoforms in tumor pathology and their different intra- or extracellular roles (cytoplasmic, nuclear or extracellular) in tumor biology. | D009369 | Neoplasms |
Clinically important variants in LGALS8 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |