Protein:ACHE |
Protein Summary |
Gene summary |
| Gene name: ACHE | ASpdb.0 ID: 43 | Gene | Gene symbol | ACHE | Gene ID | 43 |
| Gene name | acetylcholinesterase (Yt blood group) |
| Synonyms | ACEE|ARACHE|N-ACHE|YT |
| Cytomap | 7q22.1 |
| Type of gene | protein-coding |
| Description | acetylcholinesteraseYt blood groupacetylcholinesterase (Cartwright blood group)apoptosis-related acetylcholinesterase |
| Modification date | 20240411 |
| UniProtAcc | P22303 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | ACHE | GO:0003990 | acetylcholinesterase activity | 1517212 |
| Gene | ACHE | GO:0004104 | cholinesterase activity | 1517212 |
| Gene | ACHE | GO:0005518 | collagen binding | 12524166 |
| Gene | ACHE | GO:0005576 | extracellular region | 1517212 |
| Gene | ACHE | GO:0005794 | Golgi apparatus | 15454088 |
| Gene | ACHE | GO:0006581 | acetylcholine catabolic process | 1517212 |
| Gene | ACHE | GO:0007155 | cell adhesion | 15454088 |
| Gene | ACHE | GO:0016020 | membrane | 16262697 |
| Gene | ACHE | GO:0016787 | hydrolase activity | 1517212 |
| Gene | ACHE | GO:0017171 | serine hydrolase activity | 3954986 |
| Gene | ACHE | GO:0042166 | acetylcholine binding | 8349597 |
| Gene | ACHE | GO:0043236 | laminin binding | 12524166 |
| Gene | ACHE | GO:0045202 | synapse | 8460160 |
| Gene | ACHE | GO:0048471 | perinuclear region of cytoplasm | 14766237 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P22303-1 | P22303-1_4bdt_A.pdb | 4BDT | X-ray | 3.1 | A | 36 | 598 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P22303 | ACHE | P22303-1 | P22303-2 | 614 | 617 | 575 | 614 | Substitution | DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL | ASEAPSTCPGFTHGEAAPRPGLPLPLLLLHQLLLLFLSHLRRL | 575 | 617 |
| P22303 | ACHE | P22303-1 | P22303-3 | 614 | 526 | 357 | 444 | Deletion | none | none | 356 | 356 |
| P22303 | ACHE | P22303-1 | P22303-4 | 614 | 603 | 575 | 603 | Substitution | DTLDEAERQWKAEFHRWSSYMVHWKNQFD | GMQGPAGSAGRRGVGARQCNPSLLPLASE | 575 | 603 |
| P22303 | ACHE | P22303-1 | P22303-4 | 614 | 603 | 604 | 614 | Deletion | none | none | 603 | 603 |
Multiple sequence alignment of our canonical and alternatively spliced ACHE |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of ACHE |
| UniProt-id | ENSG | ENST | ENSP |
| P22303-1 | ENSG00000087085.16 | ENST00000241069.11 | ENSP00000241069.5 |
| P22303-1 | ENSG00000087085.16 | ENST00000412389.5 | ENSP00000394976.1 |
| P22303-1 | ENSG00000087085.16 | ENST00000428317.7 | ENSP00000414858.1 |
| P22303-2 | ENSG00000087085.16 | ENST00000302913.8 | ENSP00000303211.4 |
| P22303-2 | ENSG00000087085.16 | ENST00000411582.4 | ENSP00000404865.1 |
| P22303-3 | ENSG00000087085.16 | ENST00000419336.6 | ENSP00000403474.2 |
| UniProt-id | NM ID | NP ID |
| P22303-1 | NM_000665.4 | NP_000656.1 |
| P22303-1 | NM_001302622.1 | NP_001289551.1 |
| P22303-2 | NM_001302621.1 | NP_001289550.1 |
| P22303-3 | NM_001282449.1 | NP_001269378.1 |
Amino acid sequences of our canonical and alternatively spliced ACHE |
| accession_id | Protein sequence |
| P22303-1 | MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGV VDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATV GMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ |
| P22303-2 | MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGV VDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATV GMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ |
| P22303-3 | MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGV VDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATV GMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQLAGR LAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGA |
| P22303-4 | MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGV VDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATV GMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| ACHE (go to UniProt):P22303 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for ACHE |
Gene structures of our canonical and alternative spliced genes of ACHE* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P22303-1 |
| 3D view using mol* of P22303-2 |
| 3D view using mol* of P22303-3 |
| 3D view using mol* of P22303-4 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P22303-1 |
![]() |
| Ramachandran plot of P22303-3 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P22303-1 | 1.069 | 171 | 1.089 | 381.073 | 0.534 | 0.787 | 1.038 | 0.634 | 0.991 | 0.64 | 0.587 | 103,104,105,107,114,117,118,119,150,151,152,153,15 5,156,157,158,161,164,233,234,317,320,322,323,324, 325,326,327,328,368,369,372,373,478,479,480 |
| P22303-2 | 1.165 | 102 | 1.069 | 223.636 | 0.427 | 0.944 | 1.32 | 0.55 | 1.34 | 0.411 | 0.463 | 103,104,105,106,107,114,117,118,119,148,150,151,15 2,153,155,156,157,161,164,233,234,317,328,368,369, 372,478,479,482 |
| P22303-3 | 1.076 | 106 | 1.103 | 395.136 | 0.603 | 0.784 | 0.929 | 0.636 | 0.943 | 0.674 | 0.525 | 103,105,107,108,113,114,117,118,148,150,151,152,15 3,155,156,157,161,164,233,234,317,320,323,324,325, 326,327,328,382,390,392,394 |
| P22303-4 | 1.066 | 182 | 1.094 | 393.078 | 0.524 | 0.767 | 0.989 | 0.556 | 0.939 | 0.592 | 0.68 | 102,103,104,105,106,107,117,118,119,150,151,152,15 3,155,156,157,161,164,233,234,317,320,322,323,324, 325,326,327,328,368,369,372,373,396,478,479 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P22303-1_P22303-1_4bdt_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P22303-1_4bdt_A_P22303-2.pdb |
| 3D view using mol* of P22303-1_4bdt_A_P22303-3.pdb |
| 3D view using mol* of P22303-1_4bdt_A_P22303-4.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P22303-1_P22303-2.pdb |
| 3D view using mol* of P22303-1_P22303-3.pdb |
| 3D view using mol* of P22303-1_P22303-4.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P22303-1_vs_P22303-2.png |
< |
| ./stats/secondary_structure/figure/P22303-1_vs_P22303-3.png |
< |
| ./stats/secondary_structure/figure/P22303-1_vs_P22303-4.png |
< |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P22303-1_vs_P22303-2.png |
< |
| ./stats/relative_asa/P22303-1_vs_P22303-3.png |
< |
| ./stats/relative_asa/P22303-1_vs_P22303-4.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to ACHE |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P22303 | ACHE | DB04614 | (R)-tacrine(10)-hupyridone | experimental | |
| P22303 | ACHE | DB07846 | (3,4,8b-Trimethyl-3-oxido-2,3a-dihydro-1H-pyrrolo[2,3-b]indol-3-ium-7-yl) N-(2-ethylphenyl)carbamate | experimental | |
| P22303 | ACHE | DB00677 | Isoflurophate | approved, investigational, withdrawn | inhibitor |
| P22303 | ACHE | DB13503 | Tyrothricin | approved | inhibitor |
| P22303 | ACHE | DB04615 | (S)-tacrine(10)-hupyridone | experimental | |
| P22303 | ACHE | DB04616 | TACRINE(8)-4-AMINOQUINOLINE | experimental | |
| P22303 | ACHE | DB07555 | Hydroxy(oxo)(2-{(1S)-2,2,2-trifluoro-1-[2-(trimethylarsonio)ethoxy]ethyl}phenyl)ammonium | experimental | |
| P22303 | ACHE | DB02226 | 3,8-Diamino-6-Phenyl-5-[6-[1-[2-[(1,2,3,4-Tetrahydro-9-Acridinyl)Amino]Ethyl]-1h-1,2,3-Triazol-4-Yl]Hexyl]-Phenanthridinium | experimental | |
| P22303 | ACHE | DB08615 | 2-[4-(DIMETHYLAMINO)PHENYL]-6-HYDROXY-3-METHYL-1,3-BENZOTHIAZOL-3-IUM | experimental | |
| P22303 | ACHE | DB08357 | Diethylene glycol diethyl ether | experimental | |
| P22303 | ACHE | DB00122 | Choline | approved, nutraceutical | product of |
| P22303 | ACHE | DB04556 | NAP-226-90 | experimental | |
| P22303 | ACHE | DB02404 | 1-Deoxy-1-Thio-Heptaethylene Glycol | experimental | |
| P22303 | ACHE | DB00449 | Dipivefrin | approved | inhibitor |
| P22303 | ACHE | DB02166 | Propidium | experimental | |
| P22303 | ACHE | DB00898 | Ethanol | approved | activator |
| P22303 | ACHE | DB00545 | Pyridostigmine | approved, investigational | inhibitor |
| P22303 | ACHE | DB01805 | Monoisopropylphosphorylserine | experimental | |
| P22303 | ACHE | DB03740 | N-acetyl-alpha-D-glucosamine | experimental | |
| P22303 | ACHE | DB01400 | Neostigmine | approved, vet_approved | inhibitor |
| P22303 | ACHE | DB01122 | Ambenonium | approved | inhibitor |
| P22303 | ACHE | DB03814 | 2-(N-morpholino)ethanesulfonic acid | experimental | |
| P22303 | ACHE | DB04617 | (9S)-9-[(8-AMMONIOOCTYL)AMINO]-1,2,3,4,9,10-HEXAHYDROACRIDINIUM | experimental | |
| P22303 | ACHE | DB02343 | 3,6,9,12,15-Pentaoxaheptadecane | experimental | |
| P22303 | ACHE | DB00843 | Donepezil | approved | inhibitor |
| P22303 | ACHE | DB01010 | Edrophonium | approved | inhibitor |
| P22303 | ACHE | DB03359 | M-(N,N,N-Trimethylammonio)-2,2,2-Trifluoro-1,1-Dihydroxyethylbenzene | experimental | |
| P22303 | ACHE | DB00863 | Ranitidine | approved, withdrawn | inhibitor |
| P22303 | ACHE | DB00733 | Pralidoxime | approved, vet_approved | activator |
| P22303 | ACHE | DB14006 | Choline salicylate | approved, nutraceutical | product of |
| P22303 | ACHE | DB04864 | Huperzine A | approved, experimental | inhibitor |
| P22303 | ACHE | DB02825 | Methylphosphinate | experimental | |
| P22303 | ACHE | DB03283 | beta-L-fucose | experimental | |
| P22303 | ACHE | DB01199 | Tubocurarine | approved | inhibitor |
| P22303 | ACHE | DB00805 | Minaprine | approved | inhibitor |
| P22303 | ACHE | DB00483 | Gallamine triethiodide | approved | inhibitor |
| P22303 | ACHE | DB03005 | 3,8-Diamino-6-Phenyl-5-[6-[1-[2-[(1,2,3,4-Tetrahydro-9-Acridinyl)Amino]Ethyl]-1h-1,2,3-Triazol-5-Yl]Hexyl]-Phenanthridinium | experimental | |
| P22303 | ACHE | DB04114 | 3-Chloro-9-Ethyl-6,7,8,9,10,11-Hexahydro-7,11-Methanocycloocta[B]Quinolin-12-Amine | experimental | |
| P22303 | ACHE | DB12816 | Terpinen-4-ol | investigational | inhibitor |
| P22303 | ACHE | DB06525 | Ganstigmine | investigational | |
| P22303 | ACHE | DB01245 | Decamethonium | approved | inhibitor |
| P22303 | ACHE | DB04892 | Phenserine | investigational | |
| P22303 | ACHE | DB08996 | Dimetacrine | experimental, withdrawn | antagonist |
| P22303 | ACHE | DB07756 | 1-[3-({[(4-AMINO-5-FLUORO-2-METHYLQUINOLIN-3-YL)METHYL]THIO}METHYL)PHENYL]-2,2,2-TRIFLUOROETHANE-1,1-DIOL | experimental | |
| P22303 | ACHE | DB00944 | Demecarium | approved | inhibitor |
| P22303 | ACHE | DB04021 | MF268 | experimental | |
| P22303 | ACHE | DB00382 | Tacrine | approved, investigational, withdrawn | inhibitor |
| P22303 | ACHE | DB02845 | Methylphosphinic Acid | experimental | |
| P22303 | ACHE | DB08167 | Methylthioninium | experimental, investigational | |
| P22303 | ACHE | DB00989 | Rivastigmine | approved, investigational | inhibitor |
| P22303 | ACHE | DB00674 | Galantamine | approved | inhibitor |
| P22303 | ACHE | DB03348 | Huperzine B | investigational | |
| P22303 | ACHE | DB04859 | Zanapezil | investigational | |
| P22303 | ACHE | DB07701 | 1-BENZYL-4-[(5,6-DIMETHOXY-1-INDANON-2-YL)METHYL]PIPERIDINE | experimental | |
| P22303 | ACHE | DB00981 | Physostigmine | approved, investigational | inhibitor |
| P22303 | ACHE | DB02673 | (4aS,6R,8aS)-11-[8-(1,3-Dioxo-1,3-dihydro-2H-isoindol-2-yl)octyl]-6-hydroxy-3-methoxy-5,6,9,10-tetrahydro-4aH-[1]benzofuro[3a,3,2-ef][2]benzazepin-11-ium | experimental | |
| P22303 | ACHE | DB04924 | Itopride | investigational | inhibitor |
Related Diseases to ACHE |
Previous studies relating to the alternative splicing of ACHE and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| ACHE | 16516310 | Virtues and woes of AChE alternative splicing in stress-related neuropathologies. | The ACh hydrolyzing enzyme acetylcholinesterase (AChE) is a combinatorial series of proteins with variant N and C termini generated from alternate promoter usage and 3' alternative splicing. Neuronal AChE variants show indistinguishable enzymatic activity yet differ in their expression, multimeric assembly and membrane-association patterns. Differentially induced under stress, they show distinct non-hydrolytic properties and interact with different protein partners. Recent findings suggest that transcriptional and post-transcriptional regulation of AChE pre-mRNA is a neuroprotection strategy but might involve long-term damage. Specifically, variant-specific causal involvement of AChE in the progression of both neurodegenerative diseases (e.g. Alzheimer's and Parkinson's diseases) and neuromuscular syndromes (e.g. myasthenia gravis) raises the possibility that future therapeutic drugs might target specific AChE variant(s) or the corresponding RNA transcripts. | D019636 | Neurodegenerative Diseases |
| ACHE | 16516310 | Virtues and woes of AChE alternative splicing in stress-related neuropathologies. | The ACh hydrolyzing enzyme acetylcholinesterase (AChE) is a combinatorial series of proteins with variant N and C termini generated from alternate promoter usage and 3' alternative splicing. Neuronal AChE variants show indistinguishable enzymatic activity yet differ in their expression, multimeric assembly and membrane-association patterns. Differentially induced under stress, they show distinct non-hydrolytic properties and interact with different protein partners. Recent findings suggest that transcriptional and post-transcriptional regulation of AChE pre-mRNA is a neuroprotection strategy but might involve long-term damage. Specifically, variant-specific causal involvement of AChE in the progression of both neurodegenerative diseases (e.g. Alzheimer's and Parkinson's diseases) and neuromuscular syndromes (e.g. myasthenia gravis) raises the possibility that future therapeutic drugs might target specific AChE variant(s) or the corresponding RNA transcripts. | D009468 | Neuromuscular Diseases |
| ACHE | 17476278 | Acetylcholinesterase/C terminal binding protein interactions modify Ikaros functions, causing T lymphopenia. | Hematological changes induced by various stress stimuli are accompanied by replacement of the primary acetylcholinesterase (AChE) 3' splice variant acetylcholinesterase-S (AChE-S) with the myelopoietic acetylcholinesterase-R (AChE-R) variant. To search for putative acetylcholinesterase-S interactions with hematopoietic pathways, we employed a yeast two-hybrid screen. The transcriptional co-repressor C-terminal binding protein (CtBP) was identified as a protein partner of the AChE-S C terminus. In erythroleukemic K562 cells, AChE-S displayed nuclear colocalization and physical interaction with CtBP. Furthermore, co-transfected AChE-S reduced the co-repressive effect of CtBP over the hematopoietic transcription factor, Ikaros. In transgenic mice, overexpressed human (h) AChE-S mRNA induced selective bone marrow upregulation of Ikaros while suppressing FOG, another transcriptional partner of CtBP. Transgenic bone marrow cells showed a correspondingly elevated potential for producing progenitor colonies, compared with controls, while peripheral blood showed increased erythrocyte counts as opposed to reduced platelets, granulocytes and T lymphocytes. AChE's 3' alternative splicing, and the corresponding changes in AChE-S/CtBP interactions, thus emerge as being actively involved in controlling hematopoiesis and the potential for modulating immune functions, supporting reports on malfunctioning immune reactions under impaired splice site selection. | D008231 | Lymphopenia |
Clinically important variants in ACHE |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|