Protein:MSMB |
Protein Summary |
 Gene summary |
| Gene name: MSMB | ASpdb.0 ID: 4477 | Gene | Gene symbol | MSMB | Gene ID | 4477 |
| Gene name | microseminoprotein beta |
| Synonyms | HPC13|IGBF|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94 |
| Cytomap | 10q11.22 |
| Type of gene | protein-coding |
| Description | beta-microseminoproteinimmunoglobulin binding factorprostate secreted seminal plasma proteinprostate secretory protein of 94 amino acidsseminal plasma beta-inhibin |
| Modification date | 20240305 |
| UniProtAcc | P08118 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P08118-1 | P08118-1_3ix0_A.pdb | 3IX0 | X-ray | 2.3 | A | 21 | 114 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P08118 | MSMB | P08118-1 | P08118-2 | 114 | 77 | 37 | 77 | Substitution | KCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPV | MFLHLWVMTKTTAKESSRRRTASISWWRRRTQKRPVLSVNG | 37 | 77 |
| P08118 | MSMB | P08118-1 | P08118-2 | 114 | 77 | 78 | 114 | Deletion | none | none | 77 | 77 |
| Multiple sequence alignment of our canonical and alternatively spliced MSMB |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MSMB |
| UniProt-id | ENSG | ENST | ENSP |
| P08118-1 | ENSG00000263639.7 | ENST00000582163.3 | ENSP00000463092.1 |
| P08118-2 | ENSG00000263639.7 | ENST00000581478.5 | ENSP00000462641.1 |
| UniProt-id | NM ID | NP ID |
| P08118-1 | NM_002443.3 | NP_002434.1 |
| P08118-2 | NM_138634.2 | NP_619540.1 |
| Amino acid sequences of our canonical and alternatively spliced MSMB |
| accession_id | Protein sequence |
| P08118-1 | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKK |
| P08118-2 |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| MSMB (go to UniProt):P08118 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for MSMB |
| Gene structures of our canonical and alternative spliced genes of MSMB * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P08118-1 |
| 3D view using mol* of P08118-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P08118-1 |
 |
| pLDDT distribution across the protein length of P08118-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P08118-1 |
 |
| Ramachandran plot of P08118-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P08118-1 | 0.647 | 38 | 0.59 | 74.088 | 0.612 | 0.591 | 0.833 | 0.11 | 1.055 | 0.105 | 0.521 | 23,25,40,41,42,44,46,52,54,55,56,58,69
|
| P08118-2 | 0.683 | 33 | 0.68 | 106.33 | 0.774 | 0.571 | 0.726 | 0.566 | 0.623 | 0.909 | 1.109 | 25,26,27,28,29,30,33,34,36,37,40,41,44
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P08118-1_P08118-1_3ix0_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P08118-1_3ix0_A_P08118-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P08118-1_P08118-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P08118-1_vs_P08118-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P08118-1_vs_P08118-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MSMB |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to MSMB |
| Previous studies relating to the alternative splicing of MSMB and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MSMB | 7566962 | Alternative splicing of PSP94 (prostatic secretory protein of 94 amino acids) mRNA in prostate tissue. | While performing reverse transcriptase-polymerase chain reaction (RT-PCR) analysis of total mRNA from prostate cancer specimens, two forms of PSP94 cDNA were detected. RT-PCR products were analysed by Southern blotting and probing with exon-specific oligonucleotides. In the short form of PSP94 mRNA, designated as PSP57, exon III was found to be deleted. The two mRNA forms were confirmed by cloning and sequencing of the RT-PCR products and were found to result from alternative splicing. The alternatively spliced form, PSP57, was characterized by sequence analysis. PSP94 and PSP57 possess identical exons I and II, including identical secretion signal peptide and the 5' untranslated sequences. PSP57 has a frame-shifted exon IV and encodes a putative 57 amino acid protein with a novel, highly basic C-terminus of 41 amino acids. PSP57 mRNA was detected in other urogenital tissues (kidney, bladder) and in most tumor cell lines tested, but was not detectable in other tissues such as breast and lung. In prostate tumor cell lines, PSP57 mRNA was aberrantly spliced and localized in the nuclear fraction of the cell. Our results suggest the possible existence of a novel PSP protein that originates from alternative splicing of PSP94 mRNA in urogenital tissues. | D011471 | Prostatic Neoplasms |
| MSMB | 19081476 | Cancer-associated splicing variants of the CDCA1 and MSMB genes expressed in cancer cell lines and surgically resected gastric cancer tissues. | Alternative splicing is a molecular mechanism by which different combinations of exons can be alternatively spliced to produce different mRNA isoforms. Recently, several databases have been published to predict the alternative splicing of mRNA; cancer-specific alternative splicing has also been predicted with these databases. Those variants may be potentially useful targets for cancer therapy, however, the accuracy and veracity of these databases have yet to be confirmed. | D013274 | Stomach Neoplasms |
Clinically important variants in MSMB |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |