Protein:MUC1 |
Protein Summary |
Gene summary |
| Gene name: MUC1 | ASpdb.0 ID: 4582 | Gene | Gene symbol | MUC1 | Gene ID | 4582 |
| Gene name | mucin 1, cell surface associated |
| Synonyms | ADMCKD|ADMCKD1|ADTKD2|CA 15-3|CD227|Ca15-3|EMA|H23AG|KL-6|MAM6|MCD|MCKD|MCKD1|MUC-1|MUC-1/SEC|MUC-1/X|MUC1/ZD|PEM|PEMT|PUM |
| Cytomap | 1q22 |
| Type of gene | protein-coding |
| Description | mucin-1H23 antigenbreast carcinoma-associated antigen DF3cancer antigen 15-3carcinoma-associated mucinepisialinkrebs von den Lungen-6mucin 1, transmembranepeanut-reactive urinary mucinpolymorphic epithelial mucintumor associated epithelial mucin |
| Modification date | 20240407 |
| UniProtAcc | P15941 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | MUC1 | GO:0000785 | chromatin | 15710329 |
| Gene | MUC1 | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 15710329 |
| Gene | MUC1 | GO:0003712 | transcription coregulator activity | 15710329 |
| Gene | MUC1 | GO:0005886 | plasma membrane | - |
| Gene | MUC1 | GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest | 15710329 |
| Gene | MUC1 | GO:0010944 | negative regulation of transcription by competitive promoter binding | 15710329 |
| Gene | MUC1 | GO:0030330 | DNA damage response, signal transduction by p53 class mediator | 15710329 |
| Gene | MUC1 | GO:0033629 | negative regulation of cell adhesion mediated by integrin | 7698991 |
| Gene | MUC1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 15710329 |
| Gene | MUC1 | GO:0051179 | localization | 26267657 |
| Gene | MUC1 | GO:0070062 | extracellular exosome | 15326289 |
| Gene | MUC1 | GO:1902166 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator | 15710329 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P15941-1 | P15941-1_1sm3_P.pdb | 1SM3 | X-ray | 1.95 | P | 920 | 928 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P15941 | MUC1 | P15941-1 | P15941-10 | 1255 | 203 | 54 | 87 | Substitution | VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA | IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS | 54 | 87 |
| P15941 | MUC1 | P15941-1 | P15941-10 | 1255 | 203 | 88 | 1139 | Deletion | none | none | 87 | 87 |
| P15941 | MUC1 | P15941-1 | P15941-11 | 1255 | 264 | 19 | 19 | Substitution | T | TATTAPKPAT | 19 | 28 |
| P15941 | MUC1 | P15941-1 | P15941-11 | 1255 | 264 | 54 | 1053 | Deletion | none | none | 62 | 62 |
| P15941 | MUC1 | P15941-1 | P15941-12 | 1255 | 159 | 19 | 19 | Substitution | T | TATTAPKPAT | 19 | 28 |
| P15941 | MUC1 | P15941-1 | P15941-12 | 1255 | 159 | 54 | 1053 | Deletion | none | none | 62 | 62 |
| P15941 | MUC1 | P15941-1 | P15941-12 | 1255 | 159 | 1077 | 1181 | Deletion | none | none | 85 | 85 |
| P15941 | MUC1 | P15941-1 | P15941-13 | 1255 | 198 | 54 | 1035 | Deletion | none | none | 53 | 53 |
| P15941 | MUC1 | P15941-1 | P15941-13 | 1255 | 198 | 1141 | 1180 | Substitution | VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIA | GCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCAP | 159 | 198 |
| P15941 | MUC1 | P15941-1 | P15941-13 | 1255 | 198 | 1181 | 1255 | Deletion | none | none | 198 | 198 |
| P15941 | MUC1 | P15941-1 | P15941-14 | 1255 | 96 | 54 | 96 | Substitution | VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQ | IPAPTTTKSCRETFLKCFCRFINKGVFWASPILSSGQDLWWYN | 54 | 96 |
| P15941 | MUC1 | P15941-1 | P15941-14 | 1255 | 96 | 97 | 1255 | Deletion | none | none | 96 | 96 |
| P15941 | MUC1 | P15941-1 | P15941-15 | 1255 | 224 | 19 | 19 | Substitution | T | TATTAPKPAT | 19 | 28 |
| P15941 | MUC1 | P15941-1 | P15941-15 | 1255 | 224 | 54 | 1093 | Deletion | none | none | 62 | 62 |
| P15941 | MUC1 | P15941-1 | P15941-16 | 1255 | 166 | 19 | 19 | Substitution | T | TATTAPKPAT | 19 | 28 |
| P15941 | MUC1 | P15941-1 | P15941-16 | 1255 | 166 | 54 | 1151 | Deletion | none | none | 62 | 62 |
| P15941 | MUC1 | P15941-1 | P15941-17 | 1255 | 259 | 19 | 19 | Substitution | T | TATTAPKPAT | 19 | 28 |
| P15941 | MUC1 | P15941-1 | P15941-17 | 1255 | 259 | 54 | 1053 | Deletion | none | none | 62 | 62 |
| P15941 | MUC1 | P15941-1 | P15941-17 | 1255 | 259 | 1232 | 1255 | Substitution | VSAGNGGSSLSYTNPAVAATSANL | RQNGWSTMPRGALPEESQG | 241 | 259 |
| P15941 | MUC1 | P15941-1 | P15941-6 | 1255 | 230 | 54 | 70 | Substitution | VSMTSSVLSSHSPGSGS | IPAPTTTKSCRETFLKW | 54 | 70 |
| P15941 | MUC1 | P15941-1 | P15941-6 | 1255 | 230 | 71 | 1095 | Deletion | none | none | 70 | 70 |
| P15941 | MUC1 | P15941-1 | P15941-7 | 1255 | 255 | 54 | 1053 | Deletion | none | none | 53 | 53 |
| P15941 | MUC1 | P15941-1 | P15941-8 | 1255 | 273 | 54 | 1035 | Deletion | none | none | 53 | 53 |
| P15941 | MUC1 | P15941-1 | P15941-9 | 1255 | 168 | 54 | 1035 | Deletion | none | none | 53 | 53 |
| P15941 | MUC1 | P15941-1 | P15941-9 | 1255 | 168 | 1077 | 1181 | Deletion | none | none | 94 | 94 |
Multiple sequence alignment of our canonical and alternatively spliced MUC1 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MUC1 |
| UniProt-id | ENSG | ENST | ENSP |
| P15941-10 | ENSG00000185499.17 | ENST00000343256.9 | ENSP00000339690.5 |
| P15941-11 | ENSG00000185499.17 | ENST00000368392.7 | ENSP00000357377.3 |
| P15941-12 | ENSG00000185499.17 | ENST00000368396.8 | ENSP00000357381.4 |
| P15941-13 | ENSG00000185499.17 | ENST00000368393.7 | ENSP00000357378.3 |
| P15941-16 | ENSG00000185499.17 | ENST00000342482.8 | ENSP00000342814.4 |
| P15941-6 | ENSG00000185499.17 | ENST00000368398.7 | ENSP00000357383.3 |
| P15941-7 | ENSG00000185499.17 | ENST00000368390.7 | ENSP00000357375.3 |
| P15941-8 | ENSG00000185499.17 | ENST00000337604.6 | ENSP00000338983.5 |
| P15941-9 | ENSG00000185499.17 | ENST00000368389.6 | ENSP00000357374.2 |
| UniProt-id | NM ID | NP ID |
| P15941-10 | NM_001044390.2 | NP_001037855.1 |
| P15941-11 | NM_001018016.2 | NP_001018016.1 |
| P15941-12 | NM_001044392.2 | NP_001037857.1 |
| P15941-13 | NM_001204293.1 | NP_001191222.1 |
| P15941-6 | NM_001204294.1 | NP_001191223.1 |
| P15941-7 | NM_001018017.2 | NP_001018017.1 |
| P15941-8 | NM_002456.5 | NP_002447.4 |
Amino acid sequences of our canonical and alternatively spliced MUC1 |
| accession_id | Protein sequence |
| P15941-1 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGS AATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSARATTTPASKST PFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVL |
| P15941-10 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAIPAPTTTKSCRETFLKCFCRFINKGVFWASPILSSVS DVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKV |
| P15941-11 | MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIY KQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV |
| P15941-12 | MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMAVCQC |
| P15941-13 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRD ISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSGCLSVPPKELRAAGHLSSPGYL |
| P15941-14 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAIPAPTTTKSCRETFLKCFCRFINKGVFWASPILSSGQ |
| P15941-15 | MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFRPGSVVVQLTLAFREGTINVHDVETQF NQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPT |
| P15941-16 | MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNASGAGVPGWGIALLVLVCVLVALAIVYLI |
| P15941-17 | MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIY KQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV |
| P15941-6 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAIPAPTTTKSCRETFLKWPGSVVVQLTLAFREGTINVH DVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHP |
| P15941-7 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLS NIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIA |
| P15941-8 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRD ISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIA LLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATS |
| P15941-9 | MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNALSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRD |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| MUC1 (go to UniProt):P15941 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=54;End=87 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=88;End=1139 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1053 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1053 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1035 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=1141;End=1180 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=54;End=96 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=97;End=1255 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1093 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1151 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1053 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=54;End=70 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=71;End=1095 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1053 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1035 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=54;End=1035 |
| P15941 | Topological domain | 24 | 1158 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Transmembrane | 1159 | 1181 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Transmembrane | 1159 | 1181 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=1141;End=1180 |
| P15941 | Transmembrane | 1159 | 1181 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Transmembrane | 1159 | 1181 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=97;End=1255 |
| P15941 | Transmembrane | 1159 | 1181 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Topological domain | 1182 | 1255 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Topological domain | 1182 | 1255 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=97;End=1255 |
| P15941 | Topological domain | 1182 | 1255 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=1232;End=1255 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Substitution;Start=54;End=87 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Substitution;Start=54;End=96 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Substitution;Start=54;End=70 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 61 | 80 | Note=1%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Substitution;Start=54;End=87 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Substitution;Start=54;End=96 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 81 | 100 | Note=2%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 101 | 120 | Note=3;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 121 | 140 | Note=4;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 141 | 160 | Note=5;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 161 | 180 | Note=6;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 181 | 200 | Note=7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 201 | 220 | Note=8;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 221 | 240 | Note=9;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 241 | 260 | Note=10;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 261 | 280 | Note=11;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 281 | 300 | Note=12;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 301 | 320 | Note=13;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 321 | 340 | Note=14;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 341 | 360 | Note=15;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 361 | 380 | Note=16;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 381 | 400 | Note=17;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 401 | 420 | Note=18;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 421 | 440 | Note=19;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 441 | 460 | Note=20;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 461 | 480 | Note=21;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 481 | 500 | Note=22;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 501 | 520 | Note=23;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 521 | 540 | Note=24;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 541 | 560 | Note=25;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 561 | 580 | Note=26;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 581 | 600 | Note=27;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 601 | 620 | Note=28;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 621 | 640 | Note=29;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 641 | 660 | Note=30;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 661 | 680 | Note=31;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 681 | 700 | Note=32;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 701 | 720 | Note=33;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 721 | 740 | Note=34;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 741 | 760 | Note=35;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 761 | 780 | Note=36;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 781 | 800 | Note=37;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 801 | 820 | Note=38;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 821 | 840 | Note=39;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 841 | 860 | Note=40;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 861 | 880 | Note=41;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 881 | 900 | Note=42;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 901 | 920 | Note=43;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 921 | 940 | Note=44;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 941 | 960 | Note=45;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 961 | 980 | Note=46%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 981 | 1000 | Note=47%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=88;End=1139 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=97;End=1255 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1093 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1151 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=71;End=1095 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1053 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Repeat | 1001 | 1020 | Note=48%3B approximate;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:11350974;Dbxref=PMID:11350974 | Type=Deletion;Start=54;End=1035 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=88;End=1139 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1053 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1053 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Substitution;Start=1141;End=1180 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=97;End=1255 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1093 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1151 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1053 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=71;End=1095 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=54;End=1053 |
| P15941 | Domain | 1039 | 1148 | Note=SEA;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00188 | Type=Deletion;Start=1077;End=1181 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=87 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=88;End=1139 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=96 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1093 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1151 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=70 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=71;End=1095 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 23 | 1033 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=88;End=1139 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1093 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1151 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=71;End=1095 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1053 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 126 | 965 | Note=42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | Type=Deletion;Start=54;End=1035 |
| P15941 | Region | 1192 | 1228 | Note=Interaction with P53 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1192 | 1228 | Note=Interaction with P53 | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1214 | 1237 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1214 | 1237 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1214 | 1237 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=1232;End=1255 |
| P15941 | Region | 1223 | 1230 | Note=Required for interaction with GSK3B | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1223 | 1230 | Note=Required for interaction with GSK3B | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Substitution;Start=1232;End=1255 |
| P15941 | Motif | 1203 | 1206 | Note=Interaction with GRB2 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1203 | 1206 | Note=Interaction with GRB2 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Substitution;Start=1232;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Substitution;Start=1232;End=1255 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=87 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=96 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1093 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1151 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=70 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=71;End=1095 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 23 | 83 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=88;End=1139 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=54;End=96 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=97;End=1255 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1093 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1151 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=71;End=1095 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 89 | 118 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=88;End=1139 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=97;End=1255 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1093 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1151 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=71;End=1095 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1053 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 953 | 1033 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=54;End=1035 |
| P15941 | Compositional bias | 1217 | 1237 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1181;End=1255 |
| P15941 | Compositional bias | 1217 | 1237 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=97;End=1255 |
| P15941 | Compositional bias | 1217 | 1237 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=1232;End=1255 |
Gene Isoform Structures and Expression Levels for MUC1 |
Gene structures of our canonical and alternative spliced genes of MUC1* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P15941-1 |
| 3D view using mol* of P15941-10 |
| 3D view using mol* of P15941-11 |
| 3D view using mol* of P15941-12 |
| 3D view using mol* of P15941-13 |
| 3D view using mol* of P15941-14 |
| 3D view using mol* of P15941-15 |
| 3D view using mol* of P15941-16 |
| 3D view using mol* of P15941-17 |
| 3D view using mol* of P15941-6 |
| 3D view using mol* of P15941-7 |
| 3D view using mol* of P15941-8 |
| 3D view using mol* of P15941-9 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P15941-1 | 1.172 | 2675 | 1.233 | 9014.04 | 0.369 | 0.845 | 1.09 | 1.774 | 0.658 | 2.696 | 1.816 | 114,115,116,117,118,119,121,126,127,128,129,130,13 1,132,133,134,135,136,137,139,140,141,142,144,145, 146,147,150,151,152,153,154,155,159,160,161,162,16 4,166,167,170,171,172,173,174,175,179,180,181,182, 184,186,190,191,192,193,194,195,196,197,199,200,20 1,202,204,206,210,211,212,213,214,215,216,219,220, 221,222,224,226,230,231,232,233,234,235,237,239,24 0,241,242,244,246,250,251,252,253,254,255,257,259, 260,261,262,264,266,270,271,272,273,274,275,279,28 1,282,284,286,290,291,292,293,294,295,299,301,302, 304,306,310,311,312,313,314,315,319,321,322,324,32 6,330,331,332,333,334,335,339,340,341,342,344,346, 350,351,352,353,354,355,357,359,361,362,364,366,37 0,371,372,373,374,375,378,379,381,382,384,386,390, 391,392,393,394,395,399,401,402,404,406,410,411,41 2,413,415,419,420,421,422,424,426,430,431,432,433, 435,439,441,442,444,446,450,451,452,453,454,455,45 9,461,462,464,466,470,471,472,473,475,479,481,482, 484,486,490,491,492,493,495,499,501,502,504,506,51 0,511,512,513,514,515,516,519,521,524,526,530,531, 532,533,534,535,539,541,542,544,546,550,551,552,55 3,554,555,559,561,562,564,566,570,571,572,573,574, 575,579,581,582,584,586,590,591,592,593,594,595,59 9,601,604,606,610,611,612,613,615,619,621,622,624, 626,630,631,632,633,634,635,639,641,642,644,646,65 0,651,652,653,655,659,661,664,666,670,671,672,673, 674,675,679,681,682,684,686,690,691,692,693,694,69 5,699,701,702,704,706,710,711,712,713,715,719,721, 724,726,730,731,732,733,734,735,739,741,742,744,74 6,750,751,752,753,754,755,759,761,762,764,766,770, 771,772,773,774,775,779,781,782,784,786,790,791,79 2,793,794,795,799,801,802,804,806,810,811,812,813, 815,819,821,822,824,826,830,831,832,833,835,836,83 9,841,842,844,846,850,851,852,853,854,855,859,861, 862,864,866,870,871,872,873,874,875,879,881,882,88 4,886,890,891,892,893,894,895,899,901,902,904,906, 910,911,912,913,914,915,919,921,922,923,924,926,93 0,931,932,933,934,935,936,938,939,940,941,942,943, 944,945,946,947,948,949,950,954,955,956,957,958,95 9,960,961,962,963,964,967,968,969 |
| P15941-10 | 1.115 | 112 | 1.22 | 262.052 | 0.559 | 0.687 | 0.904 | 2.217 | 0.407 | 5.451 | 1 | 10,13,14,16,17,20,21,63,64,66,67,70,71,73,74,119,1 23,126,127,129,130,131,133,134 |
| P15941-11 | 0.863 | 74 | 0.796 | 241.815 | 0.651 | 0.646 | 0.889 | 0.232 | 1.228 | 0.189 | 0.88 | 18,19,21,22,60,61,62,63,64,67,74,77,78,81,106,107, 108,141,142,143 |
| P15941-12 | 0.347 | 8 | 0.174 | 8.918 | 0.814 | 0.507 | 0.79 | 0.043 | 1.216 | 0.035 | 0.718 | 99,100,102,103,104
|
| P15941-13 | 1.061 | 399 | 1.12 | 1477.987 | 0.551 | 0.703 | 0.921 | 1.096 | 0.742 | 1.477 | 1.065 | 9,10,11,13,14,15,17,18,20,21,53,54,55,56,57,58,60, 62,72,76,77,79,84,88,89,92,96,104,105,106,107,108, 109,110,111,112,113,114,122,124,126,127,129,161,16 3,165,167,168,169,171,172,174,176,177,178,179,180, 181,182,183,184,185,186,187,188,189,190,191,192,19 5 |
| P15941-14 | 0.91 | 59 | 0.968 | 181.79 | 0.638 | 0.638 | 0.861 | 1.718 | 0.42 | 4.094 | 1.027 | 7,9,10,12,13,74,75,78,79,80,82,84
|
| P15941-15 | 1.022 | 133 | 1.066 | 317.618 | 0.599 | 0.679 | 0.844 | 0.478 | 0.864 | 0.554 | 1.025 | 25,29,30,73,74,75,76,77,78,79,80,81,82,83,86,89,90 ,93,109,110,111,112,113,115 |
| P15941-16 | 0.778 | 43 | 0.805 | 95.011 | 0.656 | 0.589 | 0.816 | 1.671 | 0.505 | 3.305 | 0.462 | 3,4,6,7,10,11,14,15,90,93,94,97,100
|
| P15941-17 | 0.897 | 82 | 0.914 | 215.404 | 0.61 | 0.621 | 0.821 | 0.239 | 0.949 | 0.252 | 1.224 | 19,20,21,22,23,24,25,61,62,64,67,74,77,78,81,107,1 08,141,142 |
| P15941-6 | 1.013 | 235 | 1.049 | 494.263 | 0.399 | 0.683 | 0.906 | 0.778 | 0.923 | 0.844 | 0.582 | 73,74,75,76,77,78,79,80,81,82,83,84,85,86,87,88,89 ,92,96,109,110,111,112,113,114,115,116,117,118,119 ,121 |
| P15941-7 | 0.662 | 44 | 0.641 | 108.045 | 0.786 | 0.524 | 0.651 | 0.124 | 0.91 | 0.137 | 0.978 | 9,10,11,12,13,108,109,110,111,112,113,143,144,145, 146,148 |
| P15941-8 | 0.553 | 25 | 0.505 | 62.769 | 0.725 | 0.525 | 0.665 | 0.151 | 0.859 | 0.176 | 0.806 | 97,98,100,101,142,145,146,149
|
| P15941-9 | 0.896 | 70 | 0.844 | 137.886 | 0.485 | 0.722 | 1.06 | 0.6 | 1.151 | 0.521 | 1.09 | 5,6,7,8,9,10,11,64,65,66,67,68,70,71,72,76
|
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P15941-1_P15941-1_1sm3_P.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P15941-1_1sm3_P_P15941-10.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-11.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-12.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-13.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-14.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-15.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-16.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-17.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-6.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-7.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-8.pdb |
| 3D view using mol* of P15941-1_1sm3_P_P15941-9.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P15941-1_P15941-10.pdb |
| 3D view using mol* of P15941-1_P15941-11.pdb |
| 3D view using mol* of P15941-1_P15941-12.pdb |
| 3D view using mol* of P15941-1_P15941-13.pdb |
| 3D view using mol* of P15941-1_P15941-14.pdb |
| 3D view using mol* of P15941-1_P15941-15.pdb |
| 3D view using mol* of P15941-1_P15941-16.pdb |
| 3D view using mol* of P15941-1_P15941-17.pdb |
| 3D view using mol* of P15941-1_P15941-6.pdb |
| 3D view using mol* of P15941-1_P15941-7.pdb |
| 3D view using mol* of P15941-1_P15941-8.pdb |
| 3D view using mol* of P15941-1_P15941-9.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P15941 | Region | 1192 | 1228 | Note=Interaction with P53 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1192 | 1228 | Note=Interaction with P53 | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1223 | 1230 | Note=Required for interaction with GSK3B | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1223 | 1230 | Note=Required for interaction with GSK3B | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Deletion;Start=1181;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Deletion;Start=97;End=1255 |
| P15941 | Region | 1233 | 1241 | Note=Required for interaction with beta- and gamma-catenins | Type=Substitution;Start=1232;End=1255 |
| P15941 | Motif | 1203 | 1206 | Note=Interaction with GRB2 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1203 | 1206 | Note=Interaction with GRB2 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1229 | 1232 | Note=Interaction with SRC and ESR1 | Type=Substitution;Start=1232;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Deletion;Start=1181;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Deletion;Start=97;End=1255 |
| P15941 | Motif | 1243 | 1246 | Note=Required for interaction with AP1S2 | Type=Substitution;Start=1232;End=1255 |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MUC1 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P15941 | MUC1 | DB06584 | TG4010 | investigational |
Related Diseases to MUC1 |
Previous studies relating to the alternative splicing of MUC1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MUC1 | 2351132 | Human epithelial tumor antigen cDNA sequences. Differential splicing may generate multiple protein forms. | The isolation and characterization of complementary DNAs (cDNAs) which code for an epithelial antigen aberrantly expressed in human breast tumor tissue are described here. The only information regarding the primary structure of this potentially important antigen has been a 20-amino-acid repeat motif. We now report the complete amino acid sequences of different forms of the human epithelial tumor antigen as deduced from the nucleotide sequence of isolated non-repeat cDNAs. The diversity of protein forms is generated by a series of alternative splicing events that occur in the regions located upstream and downstream to a central tandem repeat array. Isolated cDNAs coding for the upstream region show that differential usage of alternative splice acceptor sites may generate two protein forms containing putative signal peptides of varying hydrophobicities. The complexity of possible antigen forms is further compounded by alternative splicing events occurring in the region 3' to the repeat array. The isolated cDNAs 3' to the tandem repeats indicate that whereas one mRNA transcript is colinear with the gene, and defines an open reading frame (ORF) containing 160 amino acids downstream to the repeat array, a second cDNA correlates with a mRNA that is generated by a series of splicing events. The deduced amino acid sequence of the spliced cDNA contains an ORF that is identical for 149 amino acids downstream to the repeat array with the amino acid sequence of the unspliced cDNA. At this point it diverges and continues for an additional 179 amino acids. The sequence contains a highly hydrophobic 28-amino-acid peptide, located towards the carboxyl terminus, that may correspond to a transmembrane region. The cDNAs and deduced amino acid sequences, presented here, define the complete amino acid sequences of the epithelial tumor antigen and demonstrate the existence of multiple protein forms that probably localize to different cellular and extracellular compartments. | D001943 | Breast Neoplasms |
| MUC1 | 8608966 | Preoperative diagnosis of thyroid papillary carcinoma by reverse transcriptase polymerase chain reaction of the MUC1 gene. | As thyroid nodules are common, it is imperative to recommend operation only to those with a high risk of malignancy. Fine-needle aspiration (FNA) biopsy, which is widely used for this purpose, is limited by the considerable rate of non-diagnostic or non-interpretable conclusions. Therefore, it is highly desirable to acquire a new diagnostic means for thyroid cancer. We have recently described a marked over-expression of the MUC1 gene in thyroid papillary-carcinoma tissue, as compared with various benign thyroid pathologies. As the amount of mRNA obtainable by FNA is not amenable to hybridization analysis, we amplified the mRNA sequence of the MUC1-gene upstream of the variable number tandem repeat array using the reverse-transcription polymerase chain reaction (RT-PCR). Seven out of 8 FNA samples obtained from thyroid papillary carcinoma resulted in 336 and 309 base-pair products. In contrast, in all 13 FNA samples obtained from various benign pathologies, only the smaller RT-PCR product was observed. Sequence analysis of the RT-PCR products indicates that alternative splicing of the exon 2 acceptor site accounts for the difference between the 2 amplification products. It is suggested that RT-PCR of the MUC1-gene transcript may add a biomolecular diagnostic dimension to the routine cytological preoperative FNA diagnosis. | D002291 | Carcinoma, Papillary |
| MUC1 | 8608966 | Preoperative diagnosis of thyroid papillary carcinoma by reverse transcriptase polymerase chain reaction of the MUC1 gene. | As thyroid nodules are common, it is imperative to recommend operation only to those with a high risk of malignancy. Fine-needle aspiration (FNA) biopsy, which is widely used for this purpose, is limited by the considerable rate of non-diagnostic or non-interpretable conclusions. Therefore, it is highly desirable to acquire a new diagnostic means for thyroid cancer. We have recently described a marked over-expression of the MUC1 gene in thyroid papillary-carcinoma tissue, as compared with various benign thyroid pathologies. As the amount of mRNA obtainable by FNA is not amenable to hybridization analysis, we amplified the mRNA sequence of the MUC1-gene upstream of the variable number tandem repeat array using the reverse-transcription polymerase chain reaction (RT-PCR). Seven out of 8 FNA samples obtained from thyroid papillary carcinoma resulted in 336 and 309 base-pair products. In contrast, in all 13 FNA samples obtained from various benign pathologies, only the smaller RT-PCR product was observed. Sequence analysis of the RT-PCR products indicates that alternative splicing of the exon 2 acceptor site accounts for the difference between the 2 amplification products. It is suggested that RT-PCR of the MUC1-gene transcript may add a biomolecular diagnostic dimension to the routine cytological preoperative FNA diagnosis. | D013964 | Thyroid Neoplasms |
| MUC1 | 10197628 | The breast cancer-associated MUC1 gene generates both a receptor and its cognate binding protein. | MUC1 proteins, some of which contain a mucin-like domain and others lacking this region, can be generated from the human breast cancer-associated MUC1 gene by alternative splicing. The MUC1/Y isoform is devoid of the mucin domain and is a cell membrane protein that undergoes transphosphorylation on both serine and tyrosine residues. We have identified cognate binding proteins that specifically interact with the extracellular domain of MUC1/Y. Coimmunoprecipitation analyses clearly revealed the presence of complexes composed of MUC1/Y and its cognate binding proteins in primary breast tumor tissue. MUC1/Y-expressing mammary tumor cells can be specifically targeted, in vivo, with the labeled cognate binding protein. The k(D) of MUC1/Y for its binding proteins was estimated as 1.2 nM. The MUC1/Y binding proteins are also derived from the MUC1 gene and represent the secreted mucin-like polymorphic MUC1 proteins MUC1/SEC and MUC1/REP, which contain a tandem repeat array. Whereas nonposttranslationally modified MUC1/Y bound efficiently to MUC1/SEC, the latter mucin-like protein had to be posttranslationally modified in a cell-type specific manner to bind MUC1/Y. The interaction of MUC1/Y with MUC1/SEC has important biological functional correlates: (a) it induces MUC1/Y phosphorylation; and (b) it has a pronounced effect on cell morphology. These findings suggest that MUC1/Y and MUC1/SEC form an active receptor/ cognate binding protein complex that can elicit cellular responses. The proteins comprising this complex are, thus, generated by alternative splicing from one and the same gene, namely the MUC1 gene. | D001943 | Breast Neoplasms |
| MUC1 | 12462382 | Expression of MUCI splice variants correlates with invasive growth of breast cancer cell lines. | On the basis of alternative splicing the human breast cancer associated MUCI gene codes for different protein products. MUCI splice variants A and B have been shown to be determined by a single A/G nucleotide polymorphism (SNP) in exon 2 of the MUCI gene. We now describe two new splice variants C and D and show by that in human breast cancer cell lines there is selective co-expression of these variants, namely co-expression of variants A and D. We have found that the expression of variants C and D is also determined by the same SNP in exon 2. Since the overexpression of MUCI proteins has been associated with increased invasive behavior of cancer cell lines, we quantitatively determined the mRNA expression levels of the splice variants A, B, C, and D in breast cancer cell lines and correlated them with the in vitro invasiveness of these cell lines. We revealed a significant correlation between the lack of MUCI splice variants B and C and the invasiveness of the cell lines tested. Furthermore, we showed that concomitant expression of variants A and D is associated with a GG in the genotype. These findings suggest that the invasive behavior of breast cell lines may depend on different expression patterns of the MUCI gene determined by a genetic polymorphism. | D001943 | Breast Neoplasms |
| MUC1 | 12462382 | Expression of MUCI splice variants correlates with invasive growth of breast cancer cell lines. | On the basis of alternative splicing the human breast cancer associated MUCI gene codes for different protein products. MUCI splice variants A and B have been shown to be determined by a single A/G nucleotide polymorphism (SNP) in exon 2 of the MUCI gene. We now describe two new splice variants C and D and show by that in human breast cancer cell lines there is selective co-expression of these variants, namely co-expression of variants A and D. We have found that the expression of variants C and D is also determined by the same SNP in exon 2. Since the overexpression of MUCI proteins has been associated with increased invasive behavior of cancer cell lines, we quantitatively determined the mRNA expression levels of the splice variants A, B, C, and D in breast cancer cell lines and correlated them with the in vitro invasiveness of these cell lines. We revealed a significant correlation between the lack of MUCI splice variants B and C and the invasiveness of the cell lines tested. Furthermore, we showed that concomitant expression of variants A and D is associated with a GG in the genotype. These findings suggest that the invasive behavior of breast cell lines may depend on different expression patterns of the MUCI gene determined by a genetic polymorphism. | D009361 | Neoplasm Invasiveness |
| MUC1 | 22941036 | Human mucin MUC1 RNA undergoes different types of alternative splicing resulting in multiple isoforms. | MUC1 is a transmembrane mucin with important functions in normal and transformed cells, carried out by the extracellular domain or the cytoplasmic tail. A characteristic feature of the MUC1 extracellular domain is the variable number of tandem repeats (VNTR) region. Alternative splicing may regulate MUC1 expression and possibly function. We developed an RT-PCR method for efficient isolation of MUC1 mRNA isoforms that allowed us to evaluate the extent of alternative splicing of MUC1 and elucidate some of the rules that govern this process. We cloned and analyzed 21, 24, and 36 isoforms from human tumor cell lines HeLa, MCF7, and Jurkat, respectively, and 16 from normal activated human T cells. Among the 78 MUC1 isoforms we isolated, 76 are new and different cells showed varied MUC1 expression patterns. The VNTR region of exon 2 was recognized as an intron with a fixed 5' splice site but variable 3' splice sites. We also report that the 3506 A/G SNP in exon 2 can regulate 3' splice sites selection in intron 1 and produce different MUC1 short isoform proteins. Furthermore, the SNP A to G mutation was also observed in vivo, during de novo tumor formation in MUC1(+/-)Kras(G12D/+)Pten(loxP/loxP) mice. No specific functions have been associated with previously reported short isoforms. We now report that one new G SNP-associated isoform MUC1/Y-LSP, but not the A SNP-associated isoform MUC1/Y, inhibits tumor growth in immunocompetent but not immunocompromised mice. | D002471 | Cell Transformation, Neoplastic |
| MUC1 | 24072653 | Functional polymorphism rs4072037 in MUC1 gene contributes to the susceptibility to gastric cancer: evidence from pooled 6,580 cases and 10,324 controls. | Genome-wide association studies have reported a promising association of rs4072037 with gastric cancer (GC). This variant was associated with altered physiological function of MUC1 possibly by modulating promoter activity and alternative splicing of MUC1. However, the association results were inconclusive and estimate of the effect of this variant was not well evaluated. A meta-analysis by systematically reviewing relevant reports may facilitate to address these concerns. Association studies involving MUC1 rs4072037 polymorphism and GC risk were identified up to June 30, 2012. Odds ratio (OR) and 95 % confidence interval (CI) in additive model were estimated or extracted from each study. The pooled effect size was quantitatively synthesized using meta-analysis. Heterogeneity between studies was measured by the Q test and I (2) statistic, and publication bias was evaluated by a funnel plot and the Egger's test. A total of 10 independent case-control studies including 6,580 GC cases and 10,324 controls were included in this meta-analysis. Eight of the ten studies were Asian ethnicity and two European. The G allele of MUC1 rs4072037 was significantly associated with a decreased risk of GC (OR = 0.72, 95 % CI 0.68-0.77; P = 7.82 × 10(-25)), as compared with A allele. Stratification for different ethnicity, tumor localization or type showed similar results. These findings represent important evidence for association of MUC1 rs4072037 variant with GC risk, and also provide a relatively reliable estimate of effect size. MUC1 is a strong candidate as a susceptibility gene of GC. | D020022 | Genetic Predisposition to Disease |
| MUC1 | 24072653 | Functional polymorphism rs4072037 in MUC1 gene contributes to the susceptibility to gastric cancer: evidence from pooled 6,580 cases and 10,324 controls. | Genome-wide association studies have reported a promising association of rs4072037 with gastric cancer (GC). This variant was associated with altered physiological function of MUC1 possibly by modulating promoter activity and alternative splicing of MUC1. However, the association results were inconclusive and estimate of the effect of this variant was not well evaluated. A meta-analysis by systematically reviewing relevant reports may facilitate to address these concerns. Association studies involving MUC1 rs4072037 polymorphism and GC risk were identified up to June 30, 2012. Odds ratio (OR) and 95 % confidence interval (CI) in additive model were estimated or extracted from each study. The pooled effect size was quantitatively synthesized using meta-analysis. Heterogeneity between studies was measured by the Q test and I (2) statistic, and publication bias was evaluated by a funnel plot and the Egger's test. A total of 10 independent case-control studies including 6,580 GC cases and 10,324 controls were included in this meta-analysis. Eight of the ten studies were Asian ethnicity and two European. The G allele of MUC1 rs4072037 was significantly associated with a decreased risk of GC (OR = 0.72, 95 % CI 0.68-0.77; P = 7.82 × 10(-25)), as compared with A allele. Stratification for different ethnicity, tumor localization or type showed similar results. These findings represent important evidence for association of MUC1 rs4072037 variant with GC risk, and also provide a relatively reliable estimate of effect size. MUC1 is a strong candidate as a susceptibility gene of GC. | D013274 | Stomach Neoplasms |
Clinically important variants in MUC1 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|