Protein:MYC |
Protein Summary |
 Gene summary |
| Gene name: MYC | ASpdb.0 ID: 4609 | Gene | Gene symbol | MYC | Gene ID | 4609 |
| Gene name | MYC proto-oncogene, bHLH transcription factor |
| Synonyms | MRTL|MYCC|bHLHe39|c-Myc |
| Cytomap | 8q24.21 |
| Type of gene | protein-coding |
| Description | myc proto-oncogene proteinavian myelocytomatosis viral oncogene homologclass E basic helix-loop-helix protein 39myc-related translation/localization regulatory factorproto-oncogene c-Myctranscription factor p64v-myc avian myelocytomatosis viral onco |
| Modification date | 20240416 |
| UniProtAcc | P01106 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | MYC | GO:0000082 | G1/S transition of mitotic cell cycle | 25438055 |
| Gene | MYC | GO:0000122 | negative regulation of transcription by RNA polymerase II | 9924025|10412034|18393360|19160485 |
| Gene | MYC | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 10723141 |
| Gene | MYC | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific | 9924025|10723141 |
| Gene | MYC | GO:0001046 | core promoter sequence-specific DNA binding | 30873824 |
| Gene | MYC | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific | 29203640 |
| Gene | MYC | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific | 10723141|27791094 |
| Gene | MYC | GO:0005634 | nucleus | 8782822|11793365|15358760|15994933|18393360 |
| Gene | MYC | GO:0005654 | nucleoplasm | 17558397 |
| Gene | MYC | GO:0005730 | nucleolus | 17558397|25775507 |
| Gene | MYC | GO:0006338 | chromatin remodeling | 21533051 |
| Gene | MYC | GO:0006879 | intracellular iron ion homeostasis | 9924025 |
| Gene | MYC | GO:0006974 | DNA damage response | 17873522 |
| Gene | MYC | GO:0008284 | positive regulation of cell population proliferation | 15994933 |
| Gene | MYC | GO:0010332 | response to gamma radiation | 19179467 |
| Gene | MYC | GO:0010468 | regulation of gene expression | 21447833 |
| Gene | MYC | GO:0010564 | regulation of cell cycle process | 8782822 |
| Gene | MYC | GO:0010628 | positive regulation of gene expression | 15459207 |
| Gene | MYC | GO:0032986 | protein-DNA complex disassembly | 19160485 |
| Gene | MYC | GO:0032991 | protein-containing complex | 17873522|19160485 |
| Gene | MYC | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 19179467 |
| Gene | MYC | GO:0044877 | protein-containing complex binding | 18987311 |
| Gene | MYC | GO:0045893 | positive regulation of DNA-templated transcription | 8425218|10962037|17558397|18818310 |
| Gene | MYC | GO:0045944 | positive regulation of transcription by RNA polymerase II | 10723141 |
| Gene | MYC | GO:0048146 | positive regulation of fibroblast proliferation | 9924025|18987311 |
| Gene | MYC | GO:0048147 | negative regulation of fibroblast proliferation | 10962037 |
| Gene | MYC | GO:0050679 | positive regulation of epithelial cell proliferation | 18987311 |
| Gene | MYC | GO:0051276 | chromosome organization | 10962037 |
| Gene | MYC | GO:0051782 | negative regulation of cell division | 10962037 |
| Gene | MYC | GO:0060633 | negative regulation of transcription initiation by RNA polymerase II | 29203640 |
| Gene | MYC | GO:0070371 | ERK1 and ERK2 cascade | 15459207 |
| Gene | MYC | GO:0070888 | E-box binding | 18818310|27791094 |
| Gene | MYC | GO:0071456 | cellular response to hypoxia | 15459207 |
| Gene | MYC | GO:0071466 | cellular response to xenobiotic stimulus | 17873522|19179467 |
| Gene | MYC | GO:1902255 | positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator | 10962037 |
| Gene | MYC | GO:1902895 | positive regulation of miRNA transcription | 27791094 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P01106-1 | P01106-1_5i50_A.pdb | 5I50 | X-ray | 2.7 | A | 350 | 439 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P01106 | MYC | P01106-1 | P01106-2 | 439 | 454 | 1 | 1 | Substitution | M | MDFFRVVENQQPPATM | 1 | 16 |
| Multiple sequence alignment of our canonical and alternatively spliced MYC |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MYC |
| UniProt-id | ENSG | ENST | ENSP |
| P01106-1 | ENSG00000136997.22 | ENST00000377970.6 | ENSP00000367207.3 |
| P01106-1 | ENSG00000136997.22 | ENST00000652288.1 | ENSP00000499105.1 |
| P01106-1 | ENSG00000136997.22 | ENST00000707113.1 | ENSP00000516742.1 |
| P01106-1 | ENSG00000136997.22 | ENST00000707114.1 | ENSP00000516743.1 |
| P01106-1 | ENSG00000136997.22 | ENST00000707115.1 | ENSP00000516744.1 |
| P01106-1 | ENSG00000136997.22 | ENST00000707116.1 | ENSP00000516745.1 |
| P01106-2 | ENSG00000136997.22 | ENST00000621592.8 | ENSP00000478887.2 |
| UniProt-id | NM ID | NP ID |
| P01106-2 | NM_002467.4 | NP_002458.2 |
| Amino acid sequences of our canonical and alternatively spliced MYC |
| accession_id | Protein sequence |
| P01106-1 | MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGG GSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKR QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN |
| P01106-2 | MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEE QEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLR |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| MYC (go to UniProt):P01106 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for MYC |
| Gene structures of our canonical and alternative spliced genes of MYC * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P01106-1 |
| 3D view using mol* of P01106-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P01106-1 |
 |
| pLDDT distribution across the protein length of P01106-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P01106-1 |
 |
| Ramachandran plot of P01106-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P01106-1 | 0.533 | 16 | 0.442 | 72.716 | 0.733 | 0.636 | 0.92 | 0.811 | 0.967 | 0.839 | 0.751 | 128,132,133,136,138,139,140,141
|
| P01106-2 | 0.515 | 18 | 0.44 | 43.561 | 0.772 | 0.571 | 0.663 | 0.377 | 0.923 | 0.409 | 0.811 | 386,389,390,393,403,404,405,406,407,408,410
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P01106-1_P01106-1_5i50_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P01106-1_5i50_A_P01106-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P01106-1_P01106-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P01106-1_vs_P01106-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P01106-1_vs_P01106-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MYC |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P01106 | MYC | DB01093 | Dimethyl sulfoxide | approved, vet_approved | downregulator |
| P01106 | MYC | DB00945 | Acetylsalicylic acid | approved, vet_approved | downregulator |
| P01106 | MYC | DB03756 | Doconexent | approved, investigational | inhibitor |
| P01106 | MYC | DB08813 | Nadroparin | approved, investigational | inhibitor |
Related Diseases to MYC |
| Previous studies relating to the alternative splicing of MYC and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MYC | 20010808 | HnRNP proteins controlled by c-Myc deregulate pyruvate kinase mRNA splicing in cancer. | When oxygen is abundant, quiescent cells efficiently extract energy from glucose primarily by oxidative phosphorylation, whereas under the same conditions tumour cells consume glucose more avidly, converting it to lactate. This long-observed phenomenon is known as aerobic glycolysis, and is important for cell growth. Because aerobic glycolysis is only useful to growing cells, it is tightly regulated in a proliferation-linked manner. In mammals, this is partly achieved through control of pyruvate kinase isoform expression. The embryonic pyruvate kinase isoform, PKM2, is almost universally re-expressed in cancer, and promotes aerobic glycolysis, whereas the adult isoform, PKM1, promotes oxidative phosphorylation. These two isoforms result from mutually exclusive alternative splicing of the PKM pre-mRNA, reflecting inclusion of either exon 9 (PKM1) or exon 10 (PKM2). Here we show that three heterogeneous nuclear ribonucleoprotein (hnRNP) proteins, polypyrimidine tract binding protein (PTB, also known as hnRNPI), hnRNPA1 and hnRNPA2, bind repressively to sequences flanking exon 9, resulting in exon 10 inclusion. We also demonstrate that the oncogenic transcription factor c-Myc upregulates transcription of PTB, hnRNPA1 and hnRNPA2, ensuring a high PKM2/PKM1 ratio. Establishing a relevance to cancer, we show that human gliomas overexpress c-Myc, PTB, hnRNPA1 and hnRNPA2 in a manner that correlates with PKM2 expression. Our results thus define a pathway that regulates an alternative splicing event required for tumour cell proliferation. | D009369 | Neoplasms |
Clinically important variants in MYC |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |