Protein:NCAM1 |
Protein Summary |
Gene summary |
| Gene name: NCAM1 | ASpdb.0 ID: 4684 | Gene | Gene symbol | NCAM1 | Gene ID | 4684 |
| Gene name | neural cell adhesion molecule 1 |
| Synonyms | CD56|MSK39|NCAM |
| Cytomap | 11q23.2 |
| Type of gene | protein-coding |
| Description | neural cell adhesion molecule 1antigen recognized by monoclonal antibody 5.1H11neural cell adhesion molecule, NCAM |
| Modification date | 20240305 |
| UniProtAcc | P13591 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | NCAM1 | GO:0005829 | cytosol | - |
| Gene | NCAM1 | GO:0005886 | plasma membrane | - |
| Gene | NCAM1 | GO:0009897 | external side of plasma membrane | 17213291 |
| Gene | NCAM1 | GO:0009986 | cell surface | 10766765 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P13591-2 | P13591-2_2vkw_A.pdb | 2VKW | X-ray | 2.3 | A | 506 | 702 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P13591 | NCAM1 | P13591-2 | P13591-1 | 858 | 848 | 354 | 363 | Deletion | none | none | 353 | 353 |
| P13591 | NCAM1 | P13591-2 | P13591-3 | 858 | 761 | 354 | 363 | Deletion | none | none | 353 | 353 |
| P13591 | NCAM1 | P13591-2 | P13591-3 | 858 | 761 | 609 | 609 | Substitution | Q | HSPPPPASASSSTPVPLSPPDTTWPLPALATTEPAK | 599 | 634 |
| P13591 | NCAM1 | P13591-2 | P13591-3 | 858 | 761 | 712 | 736 | Substitution | NGSPTSGLSTGAIVGILIVIFVLLL | TLGGNSASYTFVSLLFSAVTLLLLC | 737 | 761 |
| P13591 | NCAM1 | P13591-2 | P13591-3 | 858 | 761 | 737 | 858 | Deletion | none | none | 761 | 761 |
| P13591 | NCAM1 | P13591-2 | P13591-4 | 858 | 726 | 354 | 363 | Deletion | none | none | 353 | 353 |
| P13591 | NCAM1 | P13591-2 | P13591-4 | 858 | 726 | 712 | 736 | Substitution | NGSPTSGLSTGAIVGILIVIFVLLL | TLGGNSASYTFVSLLFSAVTLLLLC | 702 | 726 |
| P13591 | NCAM1 | P13591-2 | P13591-4 | 858 | 726 | 737 | 858 | Deletion | none | none | 726 | 726 |
| P13591 | NCAM1 | P13591-2 | P13591-5 | 858 | 665 | 609 | 665 | Substitution | QGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSG | HSPPPPASASSSTPVPLSPPDTTWPLPALATTEPAKNIAQNHCCNMFQAGLHNALMK | 609 | 665 |
| P13591 | NCAM1 | P13591-2 | P13591-5 | 858 | 665 | 666 | 858 | Deletion | none | none | 665 | 665 |
| P13591 | NCAM1 | P13591-2 | P13591-6 | 858 | 364 | 364 | 364 | Substitution | T | V | 364 | 364 |
| P13591 | NCAM1 | P13591-2 | P13591-6 | 858 | 364 | 365 | 858 | Deletion | none | none | 364 | 364 |
Multiple sequence alignment of our canonical and alternatively spliced NCAM1 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of NCAM1 |
| UniProt-id | ENSG | ENST | ENSP |
| P13591-2 | ENSG00000149294.18 | ENST00000316851.12 | ENSP00000318472.8 |
| P13591-1 | ENSG00000149294.18 | ENST00000531044.5 | ENSP00000484943.1 |
| P13591-3 | ENSG00000149294.18 | ENST00000621850.4 | ENSP00000480774.1 |
| P13591-4 | ENSG00000149294.18 | ENST00000621128.4 | ENSP00000481083.1 |
| P13591-6 | ENSG00000149294.18 | ENST00000529356.5 | ENSP00000482205.1 |
| UniProt-id | NM ID | NP ID |
| P13591-2 | NM_181351.4 | NP_851996.2 |
| P13591-1 | NM_000615.6 | NP_000606.3 |
| P13591-3 | NM_001076682.3 | NP_001070150.1 |
| P13591-4 | NM_001242608.1 | NP_001229537.1 |
Amino acid sequences of our canonical and alternatively spliced NCAM1 |
| accession_id | Protein sequence |
| P13591-2 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFR DGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKV NLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPN |
| P13591-1 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNY SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGS PIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIV IFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEK |
| P13591-3 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNY SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVHSPPPPASASSSTPVPLSPPDTTWPLPALATT EPAKGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKA |
| P13591-4 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNY SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGS PIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPATLGGNSASYTFVSLLFSAV |
| P13591-5 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFR DGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVHSPPPPASASSSTPVPLSPPDT |
| P13591-6 | MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDD AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS QLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| NCAM1 (go to UniProt):P13591 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=354;End=363 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=354;End=363 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=609;End=609 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=712;End=736 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=354;End=363 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=712;End=736 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=609;End=665 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=666;End=858 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=364;End=364 |
| P13591 | Topological domain | 20 | 718 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=365;End=858 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=712;End=736 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=737;End=858 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=712;End=736 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=737;End=858 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=666;End=858 |
| P13591 | Transmembrane | 719 | 739 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=365;End=858 |
| P13591 | Topological domain | 740 | 858 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=737;End=858 |
| P13591 | Topological domain | 740 | 858 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=737;End=858 |
| P13591 | Topological domain | 740 | 858 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=666;End=858 |
| P13591 | Topological domain | 740 | 858 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=365;End=858 |
| P13591 | Domain | 308 | 413 | Note=Ig-like C2-type 4 | Type=Deletion;Start=354;End=363 |
| P13591 | Domain | 308 | 413 | Note=Ig-like C2-type 4 | Type=Deletion;Start=354;End=363 |
| P13591 | Domain | 308 | 413 | Note=Ig-like C2-type 4 | Type=Deletion;Start=354;End=363 |
| P13591 | Domain | 308 | 413 | Note=Ig-like C2-type 4 | Type=Substitution;Start=364;End=364 |
| P13591 | Domain | 308 | 413 | Note=Ig-like C2-type 4 | Type=Deletion;Start=365;End=858 |
| P13591 | Domain | 416 | 501 | Note=Ig-like C2-type 5 | Type=Deletion;Start=365;End=858 |
| P13591 | Domain | 509 | 608 | Note=Fibronectin type-III 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=365;End=858 |
| P13591 | Domain | 611 | 706 | Note=Fibronectin type-III 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Substitution;Start=609;End=665 |
| P13591 | Domain | 611 | 706 | Note=Fibronectin type-III 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=666;End=858 |
| P13591 | Domain | 611 | 706 | Note=Fibronectin type-III 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=365;End=858 |
| P13591 | Region | 766 | 858 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Region | 766 | 858 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Region | 766 | 858 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=666;End=858 |
| P13591 | Region | 766 | 858 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=365;End=858 |
| P13591 | Compositional bias | 767 | 808 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Compositional bias | 767 | 808 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Compositional bias | 767 | 808 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=666;End=858 |
| P13591 | Compositional bias | 767 | 808 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=365;End=858 |
| P13591 | Compositional bias | 821 | 835 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Compositional bias | 821 | 835 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=737;End=858 |
| P13591 | Compositional bias | 821 | 835 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=666;End=858 |
| P13591 | Compositional bias | 821 | 835 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=365;End=858 |
Gene Isoform Structures and Expression Levels for NCAM1 |
Gene structures of our canonical and alternative spliced genes of NCAM1* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P13591-2 |
| 3D view using mol* of P13591-1 |
| 3D view using mol* of P13591-3 |
| 3D view using mol* of P13591-4 |
| 3D view using mol* of P13591-5 |
| 3D view using mol* of P13591-6 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P13591-2 |
![]() |
| Ramachandran plot of P13591-1 |
![]() |
| Ramachandran plot of P13591-4 |
![]() |
| Ramachandran plot of P13591-5 |
![]() |
| Ramachandran plot of P13591-6 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P13591-2 | 0.944 | 139 | 0.949 | 355.348 | 0.674 | 0.615 | 0.773 | 0.184 | 1.103 | 0.167 | 0.821 | 337,338,339,340,341,342,347,348,349,350,351,352,35 3,354,355,356,357,358,359,360,361,362,363,364,369, 371,373,374,375,377,378,396 |
| P13591-1 | 0.972 | 124 | 0.922 | 392.392 | 0.611 | 0.657 | 0.885 | 0.092 | 1.263 | 0.073 | 0.823 | 511,512,514,516,548,550,554,555,557,558,560,561,56 2,564,596,599,600,601,602,603,604,605,606,608,623, 624,625,626,628,682,683,684 |
| P13591-3 | 0.697 | 47 | 0.644 | 149.891 | 0.747 | 0.589 | 0.755 | 0.245 | 1.087 | 0.225 | 0.496 | 615,616,617,618,619,622,623,624,625,673,675,681,68 3,684,708,720 |
| P13591-4 | 0.837 | 56 | 0.724 | 158.123 | 0.529 | 0.73 | 1.071 | 0.265 | 1.281 | 0.207 | 0.867 | 511,512,513,514,596,597,599,624,625,626,627,629,63 1 |
| P13591-5 | 0.974 | 190 | 0.999 | 652.043 | 0.664 | 0.652 | 0.845 | 0.275 | 1.019 | 0.27 | 1.017 | 335,336,337,338,339,340,341,342,343,344,345,346,34 7,348,349,350,351,352,353,354,355,356,357,358,359, 360,361,362,363,364,365,366,368,369,370,371,372,37 3,374,375,377,378,382,388,389,390,391,392,393,398, 399,400 |
| P13591-6 | 0.913 | 87 | 0.939 | 393.764 | 0.711 | 0.61 | 0.761 | 0.415 | 0.931 | 0.446 | 0.521 | 325,326,327,328,329,330,331,337,338,339,340,341,34 2,343,344,346,347,348,350,352,353,354,355,356,357, 359 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P13591-2_P13591-2_2vkw_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P13591-2_2vkw_A_P13591-1.pdb |
| 3D view using mol* of P13591-2_2vkw_A_P13591-3.pdb |
| 3D view using mol* of P13591-2_2vkw_A_P13591-4.pdb |
| 3D view using mol* of P13591-2_2vkw_A_P13591-5.pdb |
| 3D view using mol* of P13591-2_2vkw_A_P13591-6.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P13591-2_P13591-1.pdb |
| 3D view using mol* of P13591-2_P13591-3.pdb |
| 3D view using mol* of P13591-2_P13591-4.pdb |
| 3D view using mol* of P13591-2_P13591-5.pdb |
| 3D view using mol* of P13591-2_P13591-6.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to NCAM1 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to NCAM1 |
Previous studies relating to the alternative splicing of NCAM1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| NCAM1 | 11685193 | Alternative mRNA splicing in colon cancer causes loss of expression of neural cell adhesion molecule. | The neural cell adhesion molecule (NCAM) has numerous isoforms resulting from alternative splicing of mRNA. The 3 major isoforms found in adult tissue are (1) a 120-kDa protein that is linked to the plasma membrane by glycosylphosphatidylinositol; (2) a 140-kDa form that has a transmembrane component and a cytoplasmic tail with unknown function; and (3) a 180-kDa isoform that has an intracellular protein that binds the cytoskeleton. NCAM is capable of homotypic binding and therefore plays a role in cell-cell adhesion for cells expressing the 180-kDa isoform by anchoring groups of cells into epithelial sheets. NCAM-180 is the isoform found in colonocytes, and loss of expression is associated with clinically aggressive colon cancers. | D003110 | Colonic Neoplasms |
Clinically important variants in NCAM1 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|