ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:NTRK2

Protein Summary

Gene summary

Gene name: NTRK2
ASpdb.0 ID: 4915
	Gene
Gene symbol	NTRK2
Gene ID	4915
Gene name	neurotrophic receptor tyrosine kinase 2
Synonyms	DEE58\|EIEE58\|GP145-TrkB\|OBHD\|TRKB\|trk-B
Cytomap	9q21.33
Type of gene	protein-coding
Description	BDNF/NT-3 growth factors receptorBDNF-tropomyosine receptor kinase Bneurotrophic tyrosine kinase receptor type 2tropomyosin-related kinase Btyrosine kinase receptor B
Modification date	20240411
UniProtAcc	Q16620

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	NTRK2	GO:0005886	plasma membrane	15494731
Gene	NTRK2	GO:0043121	neurotrophin binding	11738045
Gene	NTRK2	GO:0043235	receptor complex	23382219

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
Q16620-1	Q16620-1_4asz_A.pdb	4ASZ	X-ray	1.7	A	527	822

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
Q16620	NTRK2	Q16620-1	Q16620-2	822	477	467	477	Substitution	PASVISNDDDS	FVLFHKIPLDG	467	477
Q16620	NTRK2	Q16620-1	Q16620-2	822	477	478	822	Deletion	none	none	477	477
Q16620	NTRK2	Q16620-1	Q16620-3	822	537	529	537	Substitution	FVQHIKRHN	WPRGSPKTA	529	537
Q16620	NTRK2	Q16620-1	Q16620-3	822	537	538	822	Deletion	none	none	537	537
Q16620	NTRK2	Q16620-1	Q16620-4	822	838	465	465	Substitution	K	KDFSWFGFGKVKSRQGV	465	481
Q16620	NTRK2	Q16620-1	Q16620-5	822	553	465	465	Substitution	K	KDFSWFGFGKVKSRQGV	465	481
Q16620	NTRK2	Q16620-1	Q16620-5	822	553	529	537	Substitution	FVQHIKRHN	WPRGSPKTA	545	553
Q16620	NTRK2	Q16620-1	Q16620-5	822	553	538	822	Deletion	none	none	553	553
Q16620	NTRK2	Q16620-1	Q16620-6	822	735	710	735	Substitution	GGHTMLPIRWMPPESIMYRKFTTESD	SSCADQRPQGPLSLRDPCCICLLRLS	710	735
Q16620	NTRK2	Q16620-1	Q16620-6	822	735	736	822	Deletion	none	none	735	735
Q16620	NTRK2	Q16620-1	Q16620-7	822	321	1	156	Deletion	none	none	0	0
Q16620	NTRK2	Q16620-1	Q16620-7	822	321	467	477	Substitution	PASVISNDDDS	FVLFHKIPLDG	311	321
Q16620	NTRK2	Q16620-1	Q16620-7	822	321	478	822	Deletion	none	none	321	321

Multiple sequence alignment of our canonical and alternatively spliced NTRK2

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of NTRK2

UniProt-id	ENSG	ENST	ENSP
Q16620-1	ENSG00000148053.18	ENST00000376213.6	ENSP00000365386.1
Q16620-1	ENSG00000148053.18	ENST00000686259.1	ENSP00000509743.1
Q16620-1	ENSG00000148053.18	ENST00000686496.1	ENSP00000510060.1
Q16620-1	ENSG00000148053.18	ENST00000691788.1	ENSP00000509401.1
Q16620-1	ENSG00000148053.18	ENST00000692181.1	ENSP00000510619.1
Q16620-2	ENSG00000148053.18	ENST00000359847.4	ENSP00000352906.3
Q16620-2	ENSG00000148053.18	ENST00000395882.6	ENSP00000379221.1
Q16620-2	ENSG00000148053.18	ENST00000687148.1	ENSP00000510717.1
Q16620-2	ENSG00000148053.18	ENST00000687596.1	ENSP00000509999.1
Q16620-2	ENSG00000148053.18	ENST00000688013.1	ENSP00000508443.1
Q16620-2	ENSG00000148053.18	ENST00000689685.1	ENSP00000509169.1
Q16620-2	ENSG00000148053.18	ENST00000689815.1	ENSP00000510451.1
Q16620-2	ENSG00000148053.18	ENST00000690281.1	ENSP00000510757.1
Q16620-2	ENSG00000148053.18	ENST00000691415.1	ENSP00000509058.1
Q16620-2	ENSG00000148053.18	ENST00000692389.1	ENSP00000508497.1
Q16620-2	ENSG00000148053.18	ENST00000692506.1	ENSP00000508622.1
Q16620-2	ENSG00000148053.18	ENST00000692762.1	ENSP00000510071.1
Q16620-2	ENSG00000148053.18	ENST00000693109.1	ENSP00000509456.1
Q16620-3	ENSG00000148053.18	ENST00000304053.11	ENSP00000306167.7
Q16620-3	ENSG00000148053.18	ENST00000376208.6	ENSP00000365381.1
Q16620-3	ENSG00000148053.18	ENST00000686443.1	ENSP00000509093.1
Q16620-4	ENSG00000148053.18	ENST00000277120.8	ENSP00000277120.3
Q16620-4	ENSG00000148053.18	ENST00000686324.1	ENSP00000510134.1
Q16620-5	ENSG00000148053.18	ENST00000685720.1	ENSP00000509031.1
Q16620-5	ENSG00000148053.18	ENST00000687636.1	ENSP00000508829.1
Q16620-5	ENSG00000148053.18	ENST00000693539.1	ENSP00000510640.1
Q16620-7	ENSG00000148053.18	ENST00000686322.1	ENSP00000510032.1

UniProt-id	NM ID	NP ID
Q16620-1	NM_001018064.2	NP_001018074.1
Q16620-1	XM_011518718.2	XP_011517020.1
Q16620-1	XM_017014752.1	XP_016870241.1
Q16620-1	XM_017014753.1	XP_016870242.1
Q16620-2	NM_001007097.2	NP_001007098.1
Q16620-2	XM_017014760.1	XP_016870249.1
Q16620-3	NM_001018066.2	NP_001018076.1
Q16620-4	NM_006180.4	NP_006171.2
Q16620-4	XM_005252001.2	XP_005252058.1
Q16620-4	XM_005252003.2	XP_005252060.1
Q16620-4	XM_005252004.2	XP_005252061.1
Q16620-4	XM_017014751.1	XP_016870240.1
Q16620-5	NM_001018065.2	NP_001018075.1
Q16620-5	XM_017014755.1	XP_016870244.1

Amino acid sequences of our canonical and alternatively spliced NTRK2

accession_id	Protein sequence
Q16620-1	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM LFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR AHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNL
Q16620-2	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM
Q16620-3	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM
Q16620-4	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM LFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLI MVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREP
Q16620-5	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM LFLLKLARHSKFGMKDFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
Q16620-6	MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAEN LVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM LFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR AHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVSSCADQRPQGP
Q16620-7	MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHT QGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHV TNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKT

Protein Functional Features

Main function of this protein. (from UniProt)

NTRK2 (go to UniProt):Q16620

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q16620	Topological domain	32	430	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=1;End=156
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=467;End=477
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=478;End=822
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=529;End=537
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=538;End=822
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=465;End=465
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=465;End=465
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=529;End=537
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=538;End=822
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=710;End=735
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=736;End=822
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Substitution;Start=467;End=477
Q16620	Topological domain	455	822	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255	Type=Deletion;Start=478;End=822
Q16620	Domain	32	61	Note=LRRNT	Type=Deletion;Start=1;End=156
Q16620	Repeat	92	113	Note=LRR 1	Type=Deletion;Start=1;End=156
Q16620	Repeat	116	137	Note=LRR 2	Type=Deletion;Start=1;End=156
Q16620	Domain	148	196	Note=LRRCT	Type=Deletion;Start=1;End=156
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=478;End=822
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=538;End=822
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=538;End=822
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Substitution;Start=710;End=735
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=736;End=822
Q16620	Domain	538	807	Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00159	Type=Deletion;Start=478;End=822
Q16620	Region	455	466	Note=Interaction with MAPK8IP3/JIP3;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q63604	Type=Substitution;Start=465;End=465
Q16620	Region	455	466	Note=Interaction with MAPK8IP3/JIP3;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q63604	Type=Substitution;Start=465;End=465
Q16620	Region	475	498	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=467;End=477
Q16620	Region	475	498	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=478;End=822
Q16620	Region	475	498	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=467;End=477
Q16620	Region	475	498	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=478;End=822
Q16620	Compositional bias	475	496	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=467;End=477
Q16620	Compositional bias	475	496	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=478;End=822
Q16620	Compositional bias	475	496	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Substitution;Start=467;End=477
Q16620	Compositional bias	475	496	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=478;End=822

Gene Isoform Structures and Expression Levels for NTRK2

Gene structures of our canonical and alternative spliced genes of NTRK2
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of Q16620-1

3D view using mol* of Q16620-2

3D view using mol* of Q16620-3

3D view using mol* of Q16620-4

3D view using mol* of Q16620-5

3D view using mol* of Q16620-6

3D view using mol* of Q16620-7

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of Q16620-1

pLDDT distribution across the protein length of Q16620-2

pLDDT distribution across the protein length of Q16620-3

pLDDT distribution across the protein length of Q16620-4

pLDDT distribution across the protein length of Q16620-5

pLDDT distribution across the protein length of Q16620-6

pLDDT distribution across the protein length of Q16620-7

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of Q16620-1

Ramachandran plot of Q16620-3

Ramachandran plot of Q16620-4

Ramachandran plot of Q16620-5

Ramachandran plot of Q16620-7

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
Q16620-1	1.066	111	1.1	263.081	0.495	0.754	0.993	1.477	0.897	1.646	0.916	297,298,299,542,543,544,545,546,551,552,570,619,62 0,621,623,624,627,680,683,695,697,698,700,701,702
Q16620-2	0.946	73	0.859	122.108	0.392	0.776	1.063	1	1.257	0.796	0.421	140,141,142,143,144,145,159,162,163,166,168,170,17 1,172,174
Q16620-3	0.899	68	0.783	112.504	0.452	0.74	1.07	0.95	1.339	0.71	0.486	140,141,142,143,144,145,159,162,163,164,166,168,17 0,171,172,174
Q16620-4	1.128	116	1.152	217.119	0.45	0.855	1.171	1.749	0.921	1.898	0.968	518,519,520,521,522,524,526,563,564,565,604,607,68 8,689,690,691,692,697,710,711,712,713,714,715,716, 719,722,728,729,730,731,732,746
Q16620-5	0.95	71	0.816	122.794	0.403	0.796	1.13	0.933	1.392	0.67	0.472	142,143,144,145,159,162,163,166,167,168,170,171,17 2,174
Q16620-6	1.052	130	1.067	414.001	0.542	0.775	0.964	1.228	1.037	1.184	0.842	542,544,545,547,548,549,550,552,570,572,588,592,60 1,617,618,619,620,621,623,624,674,676,680,681,683, 693,694,695,696,697,698
Q16620-7	0.66	29	0.632	103.929	0.726	0.607	0.762	0.356	0.73	0.488	2.357	101,102,104,152,182,183,184,185

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of Q16620-1_Q16620-1_4asz_A.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q16620-1_4asz_A_Q16620-2.pdb

3D view using mol* of Q16620-1_4asz_A_Q16620-3.pdb

3D view using mol* of Q16620-1_4asz_A_Q16620-4.pdb

3D view using mol* of Q16620-1_4asz_A_Q16620-5.pdb

3D view using mol* of Q16620-1_4asz_A_Q16620-6.pdb

3D view using mol* of Q16620-1_4asz_A_Q16620-7.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q16620-1_Q16620-2.pdb

3D view using mol* of Q16620-1_Q16620-3.pdb

3D view using mol* of Q16620-1_Q16620-4.pdb

3D view using mol* of Q16620-1_Q16620-5.pdb

3D view using mol* of Q16620-1_Q16620-6.pdb

3D view using mol* of Q16620-1_Q16620-7.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-2.png

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-3.png

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-4.png

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-5.png

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-6.png

./stats/secondary_structure/figure/Q16620-1_vs_Q16620-7.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/Q16620-1_vs_Q16620-2.png

./stats/relative_asa/Q16620-1_vs_Q16620-3.png

./stats/relative_asa/Q16620-1_vs_Q16620-4.png

./stats/relative_asa/Q16620-1_vs_Q16620-5.png

./stats/relative_asa/Q16620-1_vs_Q16620-6.png

./stats/relative_asa/Q16620-1_vs_Q16620-7.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q16620	Region	455	466	Note=Interaction with MAPK8IP3/JIP3;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q63604	Type=Substitution;Start=465;End=465
Q16620	Region	455	466	Note=Interaction with MAPK8IP3/JIP3;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q63604	Type=Substitution;Start=465;End=465

Interactors from STRING.

Gene name

Interactors

Related Drugs to NTRK2

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession	Gene name	DrugBank ID	Drug name	Drug group	Actions
Q16620	NTRK2	DB14723	Larotrectinib	approved, investigational	inhibitor
Q16620	NTRK2	DB00321	Amitriptyline	approved	agonist
Q16620	NTRK2	DB11986	Entrectinib	approved, investigational	inhibitor
Q16620	NTRK2	DB12010	Fostamatinib	approved, investigational	inhibitor
Q16620	NTRK2	DB11823	Esketamine	approved, investigational
Q16620	NTRK2	DB16826	Repotrectinib	approved, investigational	inhibitor

Related Diseases to NTRK2

Previous studies relating to the alternative splicing of NTRK2 and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
NTRK2	17918233	Genetic association of neurotrophic tyrosine kinase receptor type 2 (NTRK2) With Alzheimer's disease.	Brain-derived neurotrophic factor (BDNF)/tyrosine receptor kinase (TRK) signaling pathway activates a wide range of downstream intracellular cascades, regulating neuronal development and plasticity, long-term potentiation, and apoptosis. The NTRK family encodes the receptors TRKA, TRKB, and TRKC, to which the neurotrophins, nerve growth factor (NGF), BDNF and neurotrophin-3 (NT-3) bind, respectively, with high affinity. Signaling through these receptors appears to be compromised in Alzheimer's disease (AD). This study is the most comprehensive investigation of genetic variants of NTRK2, and the first to show significant association between NTRK2 with AD. Fourteen single nucleotide polymorphisms (SNPs), located in 8 of 18 linkage disequilibrium (LD) blocks, were genotyped in 203 families with at least two AD affected siblings with mean age of onset (MAO) of 70.9 +/- 7.4 years and one unaffected sibling from the NIMH-ADGJ dataset. Family based association testing found no single SNP association, however, significant associations were found for two and three locus haplotypes (P = 0.012, P = 0.009, respectively) containing SNPs rsl624327, rsl443445, and rs378645. These SNPs are located in areas of the gene containing sequences that could be involved in alternative splicing and/or regulation of NTRK2. Our results suggest that NTRK2 may be a genetic susceptibility gene contributing to AD pathology.	D000544	Alzheimer Disease

Clinically important variants in NTRK2

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance