Protein:FOXP3 |
Protein Summary |
 Gene summary |
| Gene name: FOXP3 | ASpdb.0 ID: 50943 | Gene | Gene symbol | FOXP3 | Gene ID | 50943 |
| Gene name | forkhead box P3 |
| Synonyms | AIID|DIETER|IPEX|JM2|PIDX|XPID |
| Cytomap | Xp11.23 |
| Type of gene | protein-coding |
| Description | forkhead box protein P3FOXP3delta7immune dysregulation, polyendocrinopathy, enteropathy, X-linkedimmunodeficiency, polyendocrinopathy, enteropathy, X-linked |
| Modification date | 20240407 |
| UniProtAcc | Q9BZS1 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | FOXP3 | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific | 19276356 |
| Gene | FOXP3 | GO:0001818 | negative regulation of cytokine production | 11483607 |
| Gene | FOXP3 | GO:0002725 | negative regulation of T cell cytokine production | 15466453 |
| Gene | FOXP3 | GO:0003700 | DNA-binding transcription factor activity | 11483607|32644293 |
| Gene | FOXP3 | GO:0005634 | nucleus | 32644293 |
| Gene | FOXP3 | GO:0005634 | nucleus | 11483607|16873067|16920951|22678915|24012345 |
| Gene | FOXP3 | GO:0005654 | nucleoplasm | - |
| Gene | FOXP3 | GO:0005737 | cytoplasm | 22678915 |
| Gene | FOXP3 | GO:0005829 | cytosol | - |
| Gene | FOXP3 | GO:0008285 | negative regulation of cell population proliferation | 15652505 |
| Gene | FOXP3 | GO:0032088 | negative regulation of NF-kappaB transcription factor activity | 16652169 |
| Gene | FOXP3 | GO:0032689 | negative regulation of type II interferon production | 15466453 |
| Gene | FOXP3 | GO:0032693 | negative regulation of interleukin-10 production | 15466453 |
| Gene | FOXP3 | GO:0032703 | negative regulation of interleukin-2 production | 15466453|17360565|17377532 |
| Gene | FOXP3 | GO:0032713 | negative regulation of interleukin-4 production | 15466453 |
| Gene | FOXP3 | GO:0032792 | negative regulation of CREB transcription factor activity | 16652169 |
| Gene | FOXP3 | GO:0042110 | T cell activation | 15466453 |
| Gene | FOXP3 | GO:0042130 | negative regulation of T cell proliferation | 15466453 |
| Gene | FOXP3 | GO:0042803 | protein homodimerization activity | 21458306 |
| Gene | FOXP3 | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 16873067 |
| Gene | FOXP3 | GO:0043565 | sequence-specific DNA binding | 11483607|16873067|19276356 |
| Gene | FOXP3 | GO:0045066 | regulatory T cell differentiation | 32644293 |
| Gene | FOXP3 | GO:0045591 | positive regulation of regulatory T cell differentiation | 30513302 |
| Gene | FOXP3 | GO:0045892 | negative regulation of DNA-templated transcription | 11483607|16920951|17360565|22678915 |
| Gene | FOXP3 | GO:0045893 | positive regulation of DNA-templated transcription | 15466453 |
| Gene | FOXP3 | GO:0050777 | negative regulation of immune response | 15652505 |
| Gene | FOXP3 | GO:1990837 | sequence-specific double-stranded DNA binding | 28473536 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q9BZS1-1 | Q9BZS1-1_3qrf_F.pdb | 3QRF | X-ray | 2.8 | F | 336 | 417 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q9BZS1 | FOXP3 | Q9BZS1-1 | Q9BZS1-2 | 431 | 396 | 72 | 106 | Deletion | none | none | 71 | 71 |
| Q9BZS1 | FOXP3 | Q9BZS1-1 | Q9BZS1-3 | 431 | 456 | 72 | 106 | Deletion | none | none | 71 | 71 |
| Q9BZS1 | FOXP3 | Q9BZS1-1 | Q9BZS1-3 | 431 | 456 | 382 | 382 | Substitution | K | KVSSSEVAVTGMASSAIAAQSGQAWVWAHRHIGEERDVGCWWWLLASEVDAHLLPVPGLPQ | 347 | 407 |
| Q9BZS1 | FOXP3 | Q9BZS1-1 | Q9BZS1-4 | 431 | 404 | 246 | 272 | Deletion | none | none | 245 | 245 |
| Multiple sequence alignment of our canonical and alternatively spliced FOXP3 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of FOXP3 |
| UniProt-id | ENSG | ENST | ENSP |
| Q9BZS1-1 | ENSG00000049768.18 | ENST00000376207.10 | ENSP00000365380.4 |
| Q9BZS1-2 | ENSG00000049768.18 | ENST00000376199.7 | ENSP00000365372.2 |
| Q9BZS1-3 | ENSG00000049768.18 | ENST00000557224.6 | ENSP00000451208.1 |
| Q9BZS1-4 | ENSG00000049768.18 | ENST00000518685.6 | ENSP00000428952.2 |
| UniProt-id | NM ID | NP ID |
| Q9BZS1-1 | NM_014009.3 | NP_054728.2 |
| Q9BZS1-2 | NM_001114377.1 | NP_001107849.1 |
| Amino acid sequences of our canonical and alternatively spliced FOXP3 |
| accession_id | Protein sequence |
| Q9BZS1-1 | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLP HLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKAS SVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL |
| Q9BZS1-2 | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLSTVDAHARTPVLQVHPLES PAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFL KHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSL FAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF |
| Q9BZS1-3 | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLSTVDAHARTPVLQVHPLES PAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFL KHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSL FAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKVSSSEVAVTGMAS SAIAAQSGQAWVWAHRHIGEERDVGCWWWLLASEVDAHLLPVPGLPQNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCS |
| Q9BZS1-4 | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLP HLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQASSDKGSCCIVAAGSQGPVVPAWSG PREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRH |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| FOXP3 (go to UniProt):Q9BZS1 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q9BZS1 | DNA binding | 337 | 423 | Note=Fork-head;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00089 | Type=Substitution;Start=382;End=382 |
| Q9BZS1 | Region | 106 | 198 | Note=Interaction with ZFP90;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23543754;Dbxref=PMID:23543754 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 198 | Note=Interaction with ZFP90;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23543754;Dbxref=PMID:23543754 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 190 | Note=Essential for transcriptional repressor activity and for interaction with KAT5 and HDAC7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17360565;Dbxref=PMID:17360565 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 190 | Note=Essential for transcriptional repressor activity and for interaction with KAT5 and HDAC7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17360565;Dbxref=PMID:17360565 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 239 | 260 | Note=Leucine-zipper | Type=Deletion;Start=246;End=272 |
| Q9BZS1 | Motif | 68 | 76 | Note=Nuclear export signal;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22678915;Dbxref=PMID:22678915 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Motif | 68 | 76 | Note=Nuclear export signal;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22678915;Dbxref=PMID:22678915 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Motif | 92 | 96 | Note=LXXLL motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18354202;Dbxref=PMID:18354202 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Motif | 92 | 96 | Note=LXXLL motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18354202;Dbxref=PMID:18354202 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Motif | 239 | 248 | Note=Nuclear export signal;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22678915;Dbxref=PMID:22678915 | Type=Deletion;Start=246;End=272 |
Gene Isoform Structures and Expression Levels for FOXP3 |
| Gene structures of our canonical and alternative spliced genes of FOXP3 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q9BZS1-1 |
| 3D view using mol* of Q9BZS1-2 |
| 3D view using mol* of Q9BZS1-3 |
| 3D view using mol* of Q9BZS1-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q9BZS1-1 |
 |
| pLDDT distribution across the protein length of Q9BZS1-2 |
 |
| pLDDT distribution across the protein length of Q9BZS1-3 |
 |
| pLDDT distribution across the protein length of Q9BZS1-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q9BZS1-1 |
 |
| Ramachandran plot of Q9BZS1-2 |
 |
| Ramachandran plot of Q9BZS1-3 |
 |
| Ramachandran plot of Q9BZS1-4 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q9BZS1-1 | 1.039 | 129 | 1.107 | 417.774 | 0.626 | 0.657 | 0.877 | 0.982 | 0.696 | 1.412 | 0.752 | 92,94,95,96,98,99,100,102,103,201,202,203,204,221, 222,223,224,225,226,227,228,230,231,232,233,234,23 5,237,238,328,329,332,333 |
| Q9BZS1-2 | 0.992 | 136 | 0.979 | 320.362 | 0.579 | 0.686 | 0.939 | 0.569 | 1.141 | 0.498 | 0.495 | 275,278,279,280,281,282,283,286,302,303,304,305,30 6,307,308,309,310,312,313,339,357,358,359,375,377, 378,379,381,382,383,384,385 |
| Q9BZS1-3 | 1.051 | 97 | 1.124 | 365.981 | 0.591 | 0.671 | 0.958 | 1.149 | 0.627 | 1.833 | 1.217 | 343,346,347,348,385,388,389,391,392,395,399,400,40 1,402,403,404,405,407,411 |
| Q9BZS1-4 | 1.099 | 123 | 1.154 | 332.71 | 0.477 | 0.759 | 1.024 | 1.698 | 0.74 | 2.295 | 0.899 | 227,230,231,233,234,235,237,238,278,279,281,282,28 5,286,297,299,300,301,302,303,304,309,312,313 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q9BZS1-1_Q9BZS1-1_3qrf_F.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q9BZS1-1_3qrf_F_Q9BZS1-2.pdb |
| 3D view using mol* of Q9BZS1-1_3qrf_F_Q9BZS1-3.pdb |
| 3D view using mol* of Q9BZS1-1_3qrf_F_Q9BZS1-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q9BZS1-1_Q9BZS1-2.pdb |
| 3D view using mol* of Q9BZS1-1_Q9BZS1-3.pdb |
| 3D view using mol* of Q9BZS1-1_Q9BZS1-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q9BZS1-1_vs_Q9BZS1-2.png |
 < |
| ./stats/secondary_structure/figure/Q9BZS1-1_vs_Q9BZS1-3.png |
 < |
| ./stats/secondary_structure/figure/Q9BZS1-1_vs_Q9BZS1-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q9BZS1-1_vs_Q9BZS1-2.png |
 < |
| ./stats/relative_asa/Q9BZS1-1_vs_Q9BZS1-3.png |
 < |
| ./stats/relative_asa/Q9BZS1-1_vs_Q9BZS1-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q9BZS1 | Region | 106 | 198 | Note=Interaction with ZFP90;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23543754;Dbxref=PMID:23543754 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 198 | Note=Interaction with ZFP90;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23543754;Dbxref=PMID:23543754 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 190 | Note=Essential for transcriptional repressor activity and for interaction with KAT5 and HDAC7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17360565;Dbxref=PMID:17360565 | Type=Deletion;Start=72;End=106 |
| Q9BZS1 | Region | 106 | 190 | Note=Essential for transcriptional repressor activity and for interaction with KAT5 and HDAC7;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17360565;Dbxref=PMID:17360565 | Type=Deletion;Start=72;End=106 |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to FOXP3 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to FOXP3 |
| Previous studies relating to the alternative splicing of FOXP3 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| FOXP3 | 18413770 | The regulatory T cell-associated transcription factor FoxP3 is expressed by tumor cells. | FoxP3 is a member of the forkhead family of transcription factors critically involved in the development and function of CD25(+) regulatory T cells (Treg). Until recently, FoxP3 expression was thought to be restricted to the T-cell lineage. However, using immunohistochemistry and flow cytometric analysis of human melanoma tissue, we detected FoxP3 expression not only in the tumor infiltrating Treg but also in the melanoma cells themselves. FoxP3 is also widely expressed by established human melanoma cell lines (as determined by flow cytometry, PCR, and Western blot), as well as cell lines derived from other solid tumors. Normal B cells do not express FoxP3; however, expression could be induced after transformation with EBV in vitro and in vivo, suggesting that malignant transformation of healthy cells can induce FoxP3. In addition, a FOXP3 mRNA variant lacking exons 3 and 4 was identified in tumor cell lines but was absent from Treg. Interestingly, this alternative splicing event introduces a translation frame-shift that is predicted to encode a novel protein. Together, our results show that FoxP3, a key regulator of immune suppression, is not only expressed by Treg but also by melanoma cells, EBV-transformed B cells, and a wide variety of tumor cell lines. | D005910 | Glioma |
| FOXP3 | 18413770 | The regulatory T cell-associated transcription factor FoxP3 is expressed by tumor cells. | FoxP3 is a member of the forkhead family of transcription factors critically involved in the development and function of CD25(+) regulatory T cells (Treg). Until recently, FoxP3 expression was thought to be restricted to the T-cell lineage. However, using immunohistochemistry and flow cytometric analysis of human melanoma tissue, we detected FoxP3 expression not only in the tumor infiltrating Treg but also in the melanoma cells themselves. FoxP3 is also widely expressed by established human melanoma cell lines (as determined by flow cytometry, PCR, and Western blot), as well as cell lines derived from other solid tumors. Normal B cells do not express FoxP3; however, expression could be induced after transformation with EBV in vitro and in vivo, suggesting that malignant transformation of healthy cells can induce FoxP3. In addition, a FOXP3 mRNA variant lacking exons 3 and 4 was identified in tumor cell lines but was absent from Treg. Interestingly, this alternative splicing event introduces a translation frame-shift that is predicted to encode a novel protein. Together, our results show that FoxP3, a key regulator of immune suppression, is not only expressed by Treg but also by melanoma cells, EBV-transformed B cells, and a wide variety of tumor cell lines. | D008545 | Melanoma |
| FOXP3 | 18413770 | The regulatory T cell-associated transcription factor FoxP3 is expressed by tumor cells. | FoxP3 is a member of the forkhead family of transcription factors critically involved in the development and function of CD25(+) regulatory T cells (Treg). Until recently, FoxP3 expression was thought to be restricted to the T-cell lineage. However, using immunohistochemistry and flow cytometric analysis of human melanoma tissue, we detected FoxP3 expression not only in the tumor infiltrating Treg but also in the melanoma cells themselves. FoxP3 is also widely expressed by established human melanoma cell lines (as determined by flow cytometry, PCR, and Western blot), as well as cell lines derived from other solid tumors. Normal B cells do not express FoxP3; however, expression could be induced after transformation with EBV in vitro and in vivo, suggesting that malignant transformation of healthy cells can induce FoxP3. In addition, a FOXP3 mRNA variant lacking exons 3 and 4 was identified in tumor cell lines but was absent from Treg. Interestingly, this alternative splicing event introduces a translation frame-shift that is predicted to encode a novel protein. Together, our results show that FoxP3, a key regulator of immune suppression, is not only expressed by Treg but also by melanoma cells, EBV-transformed B cells, and a wide variety of tumor cell lines. | D011471 | Prostatic Neoplasms |
| FOXP3 | 26441347 | IL-1β promotes Th17 differentiation by inducing alternative splicing of FOXP3. | CD4(+)FOXP3(+) regulatory T (Treg) cells are essential for maintaining immunological self-tolerance. Treg cell development and function depend on the transcription factor FOXP3, which is present in several distinct isoforms due to alternative splicing. Despite the importance of FOXP3 in the proper maintenance of Treg cells, the regulation and functional consequences of FOXP3 isoform expression remains poorly understood. Here, we show that in human Treg cells IL-1β promotes excision of FOXP3 exon 7. FOXP3 is not only expressed by Treg cells but is also transiently expressed when naïve T cells differentiate into Th17 cells. Forced splicing of FOXP3 into FOXP3Δ2Δ7 strongly favored Th17 differentiation in vitro. We also found that patients with Crohn's disease express increased levels of FOXP3 transcripts lacking exon 7, which correlate with disease severity and IL-17 production. Our results demonstrate that alternative splicing of FOXP3 modulates T cell differentiation. These results highlight the importance of characterizing FOXP3 expression on an isoform basis and suggest that immune responses may be manipulated by modulating the expression of FOXP3 isoforms, which has broad implications for the treatment of autoimmune diseases. | D003424 | Crohn Disease |
Clinically important variants in FOXP3 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |