Protein:MZB1 |
Protein Summary |
 Gene summary |
| Gene name: MZB1 | ASpdb.0 ID: 51237 | Gene | Gene symbol | MZB1 | Gene ID | 51237 |
| Gene name | marginal zone B and B1 cell specific protein |
| Synonyms | MEDA-7|PACAP|pERp1 |
| Cytomap | 5q31.2 |
| Type of gene | protein-coding |
| Description | marginal zone B- and B1-cell-specific proteinHSPC190caspase-2 binding proteinmesenteric estrogen-dependent adipose 7mesenteric oestrogen-dependent adipose gene- 7plasma cell-induced ER protein 1plasma cell-induced resident ER proteinplasma cell-ind |
| Modification date | 20240416 |
| UniProtAcc | Q8WU39 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q8WU39-1 | Q8WU39-1_7aah_A.pdb | 7AAH | X-ray | 1.4 | A | 39 | 185 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-2 | 189 | 123 | 60 | 189 | Substitution | MWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL | SLLVPDVAKSGKGRDQTSYLKLWGAAGAERVGLHGCPGPELLPELAGLRSSRSGPSETSHRPRT | 60 | 123 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-3 | 189 | 97 | 1 | 92 | Deletion | none | none | 0 | 0 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-3 | 189 | 97 | 93 | 101 | Substitution | RSCSRNWQD | MPAELWLTS | 1 | 9 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-4 | 189 | 75 | 60 | 75 | Substitution | MWQNLAKAETKLHTSN | RLCSYPPHLPLTEQQS | 60 | 75 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-4 | 189 | 75 | 76 | 189 | Deletion | none | none | 75 | 75 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-5 | 189 | 62 | 60 | 62 | Substitution | MWQ | AHP | 60 | 62 |
| Q8WU39 | MZB1 | Q8WU39-1 | Q8WU39-5 | 189 | 62 | 63 | 189 | Deletion | none | none | 62 | 62 |
| Multiple sequence alignment of our canonical and alternatively spliced MZB1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MZB1 |
| UniProt-id | ENSG | ENST | ENSP |
| Q8WU39-1 | ENSG00000170476.16 | ENST00000302125.9 | ENSP00000303920.8 |
| Q8WU39-2 | ENSG00000170476.16 | ENST00000503481.5 | ENSP00000423205.1 |
| Q8WU39-4 | ENSG00000170476.16 | ENST00000417694.6 | ENSP00000415420.2 |
| UniProt-id | NM ID | NP ID |
| Q8WU39-1 | NM_016459.3 | NP_057543.2 |
| Amino acid sequences of our canonical and alternatively spliced MZB1 |
| accession_id | Protein sequence |
| Q8WU39-1 | MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDV LDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSE |
| Q8WU39-2 | MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQSLLVPDVAKSGKGRDQTSYLKLWGAAGAERV |
| Q8WU39-3 | MPAELWLTSYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKV |
| Q8WU39-4 | |
| Q8WU39-5 |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| MZB1 (go to UniProt):Q8WU39 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q8WU39 | Motif | 186 | 189 | Note=Prevents secretion from ER;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | Type=Substitution;Start=60;End=189 |
| Q8WU39 | Motif | 186 | 189 | Note=Prevents secretion from ER;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | Type=Deletion;Start=76;End=189 |
| Q8WU39 | Motif | 186 | 189 | Note=Prevents secretion from ER;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | Type=Deletion;Start=63;End=189 |
Gene Isoform Structures and Expression Levels for MZB1 |
| Gene structures of our canonical and alternative spliced genes of MZB1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q8WU39-1 |
| 3D view using mol* of Q8WU39-2 |
| 3D view using mol* of Q8WU39-3 |
| 3D view using mol* of Q8WU39-4 |
| 3D view using mol* of Q8WU39-5 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q8WU39-1 |
 |
| pLDDT distribution across the protein length of Q8WU39-2 |
 |
| pLDDT distribution across the protein length of Q8WU39-3 |
 |
| pLDDT distribution across the protein length of Q8WU39-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q8WU39-1 |
 |
| Ramachandran plot of Q8WU39-2 |
 |
| Ramachandran plot of Q8WU39-3 |
 |
| Ramachandran plot of Q8WU39-5 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q8WU39-1 | 0.875 | 80 | 0.879 | 174.244 | 0.553 | 0.624 | 0.877 | 0.46 | 1.033 | 0.446 | 0.84 | 37,43,44,45,49,52,141,142,145,146,149,150,170,171, 172,173,174,175,176,177 |
| Q8WU39-2 | 1.021 | 133 | 1.058 | 532.336 | 0.643 | 0.693 | 0.837 | 0.642 | 0.913 | 0.703 | 1.044 | 27,29,30,31,32,34,38,41,43,44,45,46,47,48,49,50,51 ,52,54,55,58,90,91,92,94,95,96,97,98,101,104,105,1 07,108,109,110,111 |
| Q8WU39-3 | 0.684 | 31 | 0.542 | 77.518 | 0.627 | 0.712 | 1.012 | 0.157 | 1.253 | 0.125 | 1.309 | 13,15,20,21,22,27,28,29,31
|
| Q8WU39-4 | 0.57 | 33 | 0.531 | 64.141 | 0.756 | 0.489 | 0.687 | 0.163 | 0.929 | 0.175 | 2.668 | 61,64,65,66,67,68,69,70,72,73
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q8WU39-1_Q8WU39-1_7aah_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WU39-1_7aah_A_Q8WU39-2.pdb |
| 3D view using mol* of Q8WU39-1_7aah_A_Q8WU39-3.pdb |
| 3D view using mol* of Q8WU39-1_7aah_A_Q8WU39-4.pdb |
| 3D view using mol* of Q8WU39-1_7aah_A_Q8WU39-5.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WU39-1_Q8WU39-2.pdb |
| 3D view using mol* of Q8WU39-1_Q8WU39-3.pdb |
| 3D view using mol* of Q8WU39-1_Q8WU39-4.pdb |
| 3D view using mol* of Q8WU39-1_Q8WU39-5.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q8WU39-1_vs_Q8WU39-2.png |
 < |
| ./stats/secondary_structure/figure/Q8WU39-1_vs_Q8WU39-3.png |
 < |
| ./stats/secondary_structure/figure/Q8WU39-1_vs_Q8WU39-4.png |
 < |
| ./stats/secondary_structure/figure/Q8WU39-1_vs_Q8WU39-5.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q8WU39-1_vs_Q8WU39-2.png |
 < |
| ./stats/relative_asa/Q8WU39-1_vs_Q8WU39-3.png |
 < |
| ./stats/relative_asa/Q8WU39-1_vs_Q8WU39-4.png |
 < |
| ./stats/relative_asa/Q8WU39-1_vs_Q8WU39-5.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MZB1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to MZB1 |
| Previous studies relating to the alternative splicing of MZB1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MZB1 | 12792799 | MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, encodes secreted-type protein with conserved cysteine residues. | Microarray analyses is applied for prognosis of gastric cancer, including risk assessments of lymph-node metastasis and peritoneal dissemination. EST AA769445 derived from an unknown gene is reported to be frequently down-regulated in intestinal-type gastric cancer based on microarray analyses. Here, we identified and characterized the gene corresponding to EST AA769445 by using bioinformatics. EST AA769445 overlapped with MGC29506 cDNA (BC021275) and PACAP cDNA (AF338109). MGC29506 protein (189 aa) and PACAP protein (123 aa) were identical in codon 1-59, but were divergent in the C-terminal region due to a frame shift caused by sixteen-base insertion in PACAP cDNA. MGC29506 and PACAP were derived from the same gene, consisting of four exons, due to alternative splicing of alternative splice-acceptor-site type. Fourteen human ESTs were the MGC29506 type, while one human EST was the PACAP type. MGC29506 was the major isoform of the MGC29506/PACAP gene on human chromosome 5q31.2. MGC29506 orthologs in other species were next searched for. AK088094 and AK008016 cDNAs with nucleotide substitutions resulting in four-amino-acid substitutions were derived from mouse Mgc29506 gene. Rat Mgc29506 gene was identified in the rat genome draft sequence AC135285. ESTs AJ396310 and AJ441435 were derived from chicken Mgc29506 gene, while ESTs BW315632 and BW251767 from ciona mgc29506 gene. N-terminal signal peptide, six cysteine residues and other amino acids were conserved among human, mouse, rat, chicken, and ciona MGC29506 proteins. MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, was found to encode secreted-type protein with six conserved cysteine residues. | D007414 | Intestinal Neoplasms |
| MZB1 | 12792799 | MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, encodes secreted-type protein with conserved cysteine residues. | Microarray analyses is applied for prognosis of gastric cancer, including risk assessments of lymph-node metastasis and peritoneal dissemination. EST AA769445 derived from an unknown gene is reported to be frequently down-regulated in intestinal-type gastric cancer based on microarray analyses. Here, we identified and characterized the gene corresponding to EST AA769445 by using bioinformatics. EST AA769445 overlapped with MGC29506 cDNA (BC021275) and PACAP cDNA (AF338109). MGC29506 protein (189 aa) and PACAP protein (123 aa) were identical in codon 1-59, but were divergent in the C-terminal region due to a frame shift caused by sixteen-base insertion in PACAP cDNA. MGC29506 and PACAP were derived from the same gene, consisting of four exons, due to alternative splicing of alternative splice-acceptor-site type. Fourteen human ESTs were the MGC29506 type, while one human EST was the PACAP type. MGC29506 was the major isoform of the MGC29506/PACAP gene on human chromosome 5q31.2. MGC29506 orthologs in other species were next searched for. AK088094 and AK008016 cDNAs with nucleotide substitutions resulting in four-amino-acid substitutions were derived from mouse Mgc29506 gene. Rat Mgc29506 gene was identified in the rat genome draft sequence AC135285. ESTs AJ396310 and AJ441435 were derived from chicken Mgc29506 gene, while ESTs BW315632 and BW251767 from ciona mgc29506 gene. N-terminal signal peptide, six cysteine residues and other amino acids were conserved among human, mouse, rat, chicken, and ciona MGC29506 proteins. MGC29506 gene, frequently down-regulated in intestinal-type gastric cancer, was found to encode secreted-type protein with six conserved cysteine residues. | D013274 | Stomach Neoplasms |
Clinically important variants in MZB1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |