Protein:PKD2 |
Protein Summary |
Gene summary |
| Gene name: PKD2 | ASpdb.0 ID: 5311 | Gene | Gene symbol | PKD2 | Gene ID | 5311 |
| Gene name | polycystin 2, transient receptor potential cation channel |
| Synonyms | APKD2|PC2|PKD4|Pc-2|TRPP2 |
| Cytomap | 4q22.1 |
| Type of gene | protein-coding |
| Description | polycystin-2autosomal dominant polycystic kidney disease type II proteinpolycystic kidney disease 2 (autosomal dominant)transient receptor potential cation channel subfamily P member 2 |
| Modification date | 20240411 |
| UniProtAcc | Q13563 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | PKD2 | GO:0005244 | voltage-gated monoatomic ion channel activity | 11854751 |
| Gene | PKD2 | GO:0005245 | voltage-gated calcium channel activity | 11252306|15692563 |
| Gene | PKD2 | GO:0005248 | voltage-gated sodium channel activity | 11252306 |
| Gene | PKD2 | GO:0005262 | calcium channel activity | 27214281 |
| Gene | PKD2 | GO:0005267 | potassium channel activity | 26269590 |
| Gene | PKD2 | GO:0005509 | calcium ion binding | 24990821 |
| Gene | PKD2 | GO:0005737 | cytoplasm | 10770959 |
| Gene | PKD2 | GO:0005783 | endoplasmic reticulum | 10760273|15123714|15692563|19801576|28154160 |
| Gene | PKD2 | GO:0005789 | endoplasmic reticulum membrane | 11854751|15001556 |
| Gene | PKD2 | GO:0005829 | cytosol | - |
| Gene | PKD2 | GO:0005886 | plasma membrane | 15692563|16025301|21044049|26269590|28092368|29899465|30093605 |
| Gene | PKD2 | GO:0005929 | cilium | 28154160 |
| Gene | PKD2 | GO:0006816 | calcium ion transport | 11252306|27214281 |
| Gene | PKD2 | GO:0007166 | cell surface receptor signaling pathway | 27214281 |
| Gene | PKD2 | GO:0008092 | cytoskeletal protein binding | 10760273 |
| Gene | PKD2 | GO:0009925 | basal plasma membrane | 10770959 |
| Gene | PKD2 | GO:0016020 | membrane | 30093605 |
| Gene | PKD2 | GO:0022843 | voltage-gated monoatomic cation channel activity | 11252306 |
| Gene | PKD2 | GO:0030027 | lamellipodium | 10760273 |
| Gene | PKD2 | GO:0034703 | cation channel complex | 30093605 |
| Gene | PKD2 | GO:0035725 | sodium ion transmembrane transport | 11252306 |
| Gene | PKD2 | GO:0036064 | ciliary basal body | 15337773 |
| Gene | PKD2 | GO:0042803 | protein homodimerization activity | 9192675 |
| Gene | PKD2 | GO:0042805 | actinin binding | 15843396 |
| Gene | PKD2 | GO:0045180 | basal cortex | 10770959 |
| Gene | PKD2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 16311606 |
| Gene | PKD2 | GO:0048763 | calcium-induced calcium release activity | 11854751 |
| Gene | PKD2 | GO:0051209 | release of sequestered calcium ion into cytosol | 11854751 |
| Gene | PKD2 | GO:0051262 | protein tetramerization | 29899465 |
| Gene | PKD2 | GO:0051289 | protein homotetramerization | 28092368 |
| Gene | PKD2 | GO:0051290 | protein heterotetramerization | 30093605 |
| Gene | PKD2 | GO:0070062 | extracellular exosome | 37681898 |
| Gene | PKD2 | GO:0070588 | calcium ion transmembrane transport | 11854751 |
| Gene | PKD2 | GO:0071464 | cellular response to hydrostatic pressure | 16025301 |
| Gene | PKD2 | GO:0071470 | cellular response to osmotic stress | 16025301 |
| Gene | PKD2 | GO:0071805 | potassium ion transmembrane transport | 26269590 |
| Gene | PKD2 | GO:0072686 | mitotic spindle | 15123714 |
| Gene | PKD2 | GO:0090279 | regulation of calcium ion import | 11854751 |
| Gene | PKD2 | GO:0098553 | lumenal side of endoplasmic reticulum membrane | 21044049 |
| Gene | PKD2 | GO:0098554 | cytoplasmic side of endoplasmic reticulum membrane | 21044049 |
| Gene | PKD2 | GO:0140494 | migrasome | 37681898 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q13563-1 | Q13563-1_5k47_A.pdb | 5K47 | EM | 4.2 | A | 213 | 702 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q13563 | PKD2 | Q13563-1 | Q13563-2 | 968 | 483 | 476 | 483 | Substitution | CEIIFCFF | FICSSYGD | 476 | 483 |
| Q13563 | PKD2 | Q13563-1 | Q13563-2 | 968 | 483 | 484 | 968 | Deletion | none | none | 483 | 483 |
| Q13563 | PKD2 | Q13563-1 | Q13563-3 | 968 | 912 | 517 | 572 | Deletion | none | none | 516 | 516 |
| Q13563 | PKD2 | Q13563-1 | Q13563-4 | 968 | 646 | 633 | 646 | Substitution | IFTQFRIILGDINF | IICSWRSSMIRTLK | 633 | 646 |
| Q13563 | PKD2 | Q13563-1 | Q13563-4 | 968 | 646 | 647 | 968 | Deletion | none | none | 646 | 646 |
| Q13563 | PKD2 | Q13563-1 | Q13563-5 | 968 | 874 | 748 | 841 | Deletion | none | none | 747 | 747 |
Multiple sequence alignment of our canonical and alternatively spliced PKD2 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of PKD2 |
| UniProt-id | ENSG | ENST | ENSP |
| Q13563-1 | ENSG00000118762.8 | ENST00000237596.7 | ENSP00000237596.2 |
| UniProt-id | NM ID | NP ID |
| Q13563-1 | NM_000297.3 | NP_000288.1 |
Amino acid sequences of our canonical and alternatively spliced PKD2 |
| accession_id | Protein sequence |
| Q13563-1 | MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRD NPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNF KTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG VIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQ ECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN TVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLD DSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEI |
| Q13563-2 | MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRD NPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNF KTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG |
| Q13563-3 | MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRD NPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNF KTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG VIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLFKFINFNRTMSQLSTTMSRCAKD LFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSE VKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQ QMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVK LEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGME |
| Q13563-4 | MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRD NPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNF KTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG VIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQ |
| Q13563-5 | MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRD NPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNF KTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGG VIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQ ECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN TVDDISESLRQGGGKLNFDELRQDLKGLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQ |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| PKD2 (go to UniProt):Q13563 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q13563 | Transmembrane | 469 | 489 | "Note=Helical%3B Name%3DS2;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 469 | 489 | "Note=Helical%3B Name%3DS2;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 490 | 505 | "Note=Cytoplasmic;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 506 | 526 | "Note=Helical%3B Name%3DS3;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 506 | 526 | "Note=Helical%3B Name%3DS3;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 527 | 552 | "Note=Extracellular;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 527 | 552 | "Note=Extracellular;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 553 | 573 | "Note=Helical%3B Name%3DS4;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 553 | 573 | "Note=Helical%3B Name%3DS4;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 574 | 597 | "Note=Cytoplasmic;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 598 | 619 | "Note=Helical%3B Name%3D5;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 620 | 631 | "Note=Extracellular;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Intramembrane | 632 | 646 | "Note=Pore-forming;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Intramembrane | 632 | 646 | "Note=Pore-forming;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 647 | 654 | "Note=Extracellular;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 647 | 654 | "Note=Extracellular;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 655 | 675 | "Note=Helical%3B Name%3DS6;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Transmembrane | 655 | 675 | "Note=Helical%3B Name%3DS6;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 676 | 968 | "Note=Cytoplasmic;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 676 | 968 | "Note=Cytoplasmic;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Topological domain | 676 | 968 | "Note=Cytoplasmic;Ontology_term=ECO:0000269 | ECO:0000269 |
| Q13563 | Domain | 750 | 785 | "Note=EF-hand;Ontology_term=ECO:0000255 | ECO:0000269 |
| Q13563 | Domain | 750 | 785 | "Note=EF-hand;Ontology_term=ECO:0000255 | ECO:0000269 |
| Q13563 | Domain | 750 | 785 | "Note=EF-hand;Ontology_term=ECO:0000255 | ECO:0000269 |
| Q13563 | Region | 764 | 831 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=484;End=968 |
| Q13563 | Region | 764 | 831 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=647;End=968 |
| Q13563 | Region | 764 | 831 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=748;End=841 |
| Q13563 | Region | 803 | 822 | Note=Linker;Ontology_term=ECO:0000305;evidence=ECO:0000305|PubMed:18694932;Dbxref=PMID:18694932 | Type=Deletion;Start=484;End=968 |
| Q13563 | Region | 803 | 822 | Note=Linker;Ontology_term=ECO:0000305;evidence=ECO:0000305|PubMed:18694932;Dbxref=PMID:18694932 | Type=Deletion;Start=647;End=968 |
| Q13563 | Region | 803 | 822 | Note=Linker;Ontology_term=ECO:0000305;evidence=ECO:0000305|PubMed:18694932;Dbxref=PMID:18694932 | Type=Deletion;Start=748;End=841 |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=484;End=968 |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=647;End=968 |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=748;End=841 |
| Q13563 | Region | 917 | 968 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=484;End=968 |
| Q13563 | Region | 917 | 968 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=647;End=968 |
| Q13563 | Coiled coil | 833 | 872 | "Ontology_term=ECO:0000269 | ECO:0000305;evidence=ECO:0000269|PubMed:19556541 |
| Q13563 | Coiled coil | 833 | 872 | "Ontology_term=ECO:0000269 | ECO:0000305;evidence=ECO:0000269|PubMed:19556541 |
| Q13563 | Coiled coil | 833 | 872 | "Ontology_term=ECO:0000269 | ECO:0000305;evidence=ECO:0000269|PubMed:19556541 |
| Q13563 | Motif | 641 | 643 | Note=Selectivity filter;Ontology_term=ECO:0000305;evidence=ECO:0000305|PubMed:28092368;Dbxref=PMID:28092368 | Type=Deletion;Start=484;End=968 |
| Q13563 | Motif | 641 | 643 | Note=Selectivity filter;Ontology_term=ECO:0000305;evidence=ECO:0000305|PubMed:28092368;Dbxref=PMID:28092368 | Type=Substitution;Start=633;End=646 |
| Q13563 | Compositional bias | 764 | 794 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=484;End=968 |
| Q13563 | Compositional bias | 764 | 794 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=647;End=968 |
| Q13563 | Compositional bias | 764 | 794 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=748;End=841 |
| Q13563 | Compositional bias | 937 | 968 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=484;End=968 |
| Q13563 | Compositional bias | 937 | 968 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=647;End=968 |
Gene Isoform Structures and Expression Levels for PKD2 |
Gene structures of our canonical and alternative spliced genes of PKD2* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q13563-1 |
| 3D view using mol* of Q13563-2 |
| 3D view using mol* of Q13563-3 |
| 3D view using mol* of Q13563-4 |
| 3D view using mol* of Q13563-5 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q13563-1 |
![]() |
| Ramachandran plot of Q13563-2 |
![]() |
| Ramachandran plot of Q13563-4 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q13563-1 | 1.069 | 735 | 1.099 | 1860.089 | 0.451 | 0.767 | 1.006 | 1.141 | 0.922 | 1.236 | 0.982 | 46,47,48,49,50,51,52,53,54,55,56,57,58,59,60,61,62 ,64,65,234,237,238,239,240,241,242,243,245,246,247 ,250,251,254,255,258,259,271,378,379,380,381,382,3 85,433,434,435,438,440,442,454,455,456,457,458,459 ,460,461,462,464,465,469,470,473,474,477,480,481,5 17,518,521,522,525,526,528,529,532,552,553,555,556 ,557,558,559,560,561,562,563,564,565,566,624,625,6 28,630,631,634,635,637,638,641 |
| Q13563-2 | 1.004 | 337 | 1.044 | 917.525 | 0.579 | 0.666 | 0.861 | 0.692 | 0.907 | 0.762 | 1.185 | 45,46,48,49,50,52,55,239,240,241,242,243,245,246,2 92,293,294,295,296,297,298,299,300,301,302,303,304 ,305,306,307,308,311,312,314,315,397,398,399,400,4 29,431,432,433,434,435,459,460,461,462,463,464,465 ,466,467,469,470,473,474,477 |
| Q13563-3 | 1.016 | 110 | 1.036 | 335.797 | 0.565 | 0.716 | 0.954 | 0.653 | 1.022 | 0.638 | 0.693 | 238,239,240,241,242,243,246,316,427,433,434,435,43 6,438,459,460,461,462,464,465,466,467,469,470,473, 474 |
| Q13563-4 | 1.109 | 256 | 1.16 | 468.538 | 0.503 | 0.78 | 1.009 | 1.818 | 0.763 | 2.385 | 0.978 | 234,237,238,239,240,241,242,243,244,245,246,433,43 4,435,458,459,460,461,462,464,465,466,467,469,470, 473,474,477,480,481,518,521,522,525,526,528,532,55 5,558,559,562,563,565,566 |
| Q13563-5 | 1.188 | 108 | 1.254 | 173.558 | 0.435 | 0.855 | 1.11 | 3.132 | 0.611 | 5.126 | 0.312 | 234,237,238,241,242,464,477,480,481,518,521,522,52 5,526,528,558,559,562,563,565,566 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q13563-1_Q13563-1_5k47_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q13563-1_5k47_A_Q13563-2.pdb |
| 3D view using mol* of Q13563-1_5k47_A_Q13563-3.pdb |
| 3D view using mol* of Q13563-1_5k47_A_Q13563-4.pdb |
| 3D view using mol* of Q13563-1_5k47_A_Q13563-5.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q13563-1_Q13563-2.pdb |
| 3D view using mol* of Q13563-1_Q13563-3.pdb |
| 3D view using mol* of Q13563-1_Q13563-4.pdb |
| 3D view using mol* of Q13563-1_Q13563-5.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q13563-1_vs_Q13563-2.png |
< |
| ./stats/relative_asa/Q13563-1_vs_Q13563-3.png |
< |
| ./stats/relative_asa/Q13563-1_vs_Q13563-4.png |
< |
| ./stats/relative_asa/Q13563-1_vs_Q13563-5.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=484;End=968 |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=647;End=968 |
| Q13563 | Region | 810 | 821 | Note=Important for interaction with PACS1 and PACS2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15692563;Dbxref=PMID:15692563 | Type=Deletion;Start=748;End=841 |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to PKD2 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to PKD2 |
Previous studies relating to the alternative splicing of PKD2 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| PKD2 | 12527301 | Polycystin-2 associates with tropomyosin-1, an actin microfilament component. | Polycystin-2 (PC2) is the product of the second cloned gene (PKD2) responsible for autosomal dominant polycystic kidney disease and has recently been shown to be a calcium-permeable cation channel. PC2 has been shown to connect indirectly with the actin microfilament. Here, we report a direct association between PC2 and the actin microfilament. Using a yeast two-hybrid screen, we identified a specific interaction between the PC2 cytoplasmic C-terminal domain and tropomyosin-1 (TM-1), a component of the actin microfilament complex. Tropomyosins constitute a protein family of more than 20 isoforms arising mainly from alternative splicing and are present in muscle as well as non-muscle cells. We identified a new TM-1 splicing isoform in kidney and heart (TM-1a) that differs from TM-1 in the C terminus and interacted with PC2. In vitro biochemical methods, including GST pull-down, blot overlay and microtiter binding assays, confirmed the interaction between PC2 and the two TM-1 isoforms. Further experiments targeted the interacting domains to G821-R878 of PC2 and A152-E196, a common segment of TM-1 and TM-1a. Indirect double immunofluorescence experiments showed partial co-localization of PC2 and TM-1 in transfected mouse fibroblast NIH 3T3 cells. Co-immunoprecipitation (co-IP) studies using 3T3 cells and Xenopus oocytes co-expressing PC2 and TM-1 (or TM-1a) revealed in vivo association between the protein pairs. Furthermore, the in vivo interaction between the endogenous PC2 and TM-1 was demonstrated also by reciprocal co-IP using native human embryonic kidney cells and human adult kidney. Considering previous reports that TM-1 acts as a suppressor of neoplastic growth of transformed cells, it is possible that TM-1 contributes to cyst formation/growth when the anchorage of PC2 to the actin microfilament via TM-1 is altered. | D016891 | Polycystic Kidney, Autosomal Dominant |
Clinically important variants in PKD2 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|