Protein:DGCR8 |
Protein Summary |
 Gene summary |
| Gene name: DGCR8 | ASpdb.0 ID: 54487 | Gene | Gene symbol | DGCR8 | Gene ID | 54487 |
| Gene name | DGCR8 microprocessor complex subunit |
| Synonyms | C22orf12|DGCRK6|Gy1|pasha |
| Cytomap | 22q11.21 |
| Type of gene | protein-coding |
| Description | microprocessor complex subunit DGCR8DiGeorge syndrome critical region 8DiGeorge syndrome critical region gene 8 |
| Modification date | 20240411 |
| UniProtAcc | Q8WYQ5 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | DGCR8 | GO:0003725 | double-stranded RNA binding | 17704815 |
| Gene | DGCR8 | GO:0005634 | nucleus | 15574589 |
| Gene | DGCR8 | GO:0005654 | nucleoplasm | - |
| Gene | DGCR8 | GO:0005737 | cytoplasm | - |
| Gene | DGCR8 | GO:0005829 | cytosol | - |
| Gene | DGCR8 | GO:0006974 | DNA damage response | 34188037 |
| Gene | DGCR8 | GO:0016604 | nuclear body | - |
| Gene | DGCR8 | GO:0020037 | heme binding | 24449907|24910438 |
| Gene | DGCR8 | GO:0030674 | protein-macromolecule adaptor activity | 34188037 |
| Gene | DGCR8 | GO:0031053 | primary miRNA processing | 15531877|15574589 |
| Gene | DGCR8 | GO:0031053 | primary miRNA processing | 15574589|24449907|24910438 |
| Gene | DGCR8 | GO:0042803 | protein homodimerization activity | 15574589 |
| Gene | DGCR8 | GO:0070877 | microprocessor complex | 15574589 |
| Gene | DGCR8 | GO:0070878 | primary miRNA binding | 24910438 |
| Gene | DGCR8 | GO:0140517 | protein-RNA adaptor activity | 15574589 |
| Gene | DGCR8 | GO:2000633 | positive regulation of pre-miRNA processing | 15574589|32926445 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q8WYQ5-1 | Q8WYQ5-1_6v5b_C.pdb | 6V5B | EM | 3.7 | C | 493 | 750 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q8WYQ5 | DGCR8 | Q8WYQ5-1 | Q8WYQ5-2 | 773 | 304 | 303 | 304 | Substitution | LP | VL | 303 | 304 |
| Q8WYQ5 | DGCR8 | Q8WYQ5-1 | Q8WYQ5-2 | 773 | 304 | 305 | 773 | Deletion | none | none | 304 | 304 |
| Q8WYQ5 | DGCR8 | Q8WYQ5-1 | Q8WYQ5-3 | 773 | 740 | 536 | 568 | Deletion | none | none | 535 | 535 |
| Multiple sequence alignment of our canonical and alternatively spliced DGCR8 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of DGCR8 |
| UniProt-id | ENSG | ENST | ENSP |
| Q8WYQ5-1 | ENSG00000128191.17 | ENST00000351989.8 | ENSP00000263209.3 |
| Q8WYQ5-1 | ENSG00000128191.17 | ENST00000457069.2 | ENSP00000409625.2 |
| Q8WYQ5-3 | ENSG00000128191.17 | ENST00000407755.2 | ENSP00000384726.1 |
| UniProt-id | NM ID | NP ID |
| Q8WYQ5-1 | NM_022720.6 | NP_073557.3 |
| Q8WYQ5-3 | NM_001190326.1 | NP_001177255.1 |
| Amino acid sequences of our canonical and alternatively spliced DGCR8 |
| accession_id | Protein sequence |
| Q8WYQ5-1 | METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPN CSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGD SDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGALGQVKAKVEVCKDESVDLEEFRSYLEKRFDF EQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSE PFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR NHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQ |
| Q8WYQ5-2 | METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPN CSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGD |
| Q8WYQ5-3 | METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPN CSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESAD KKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGD SDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD NEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGALGQVKAKVEVCKDESVDLEEFRSYLEKRFDF EQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECARATL EILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVR GWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKP |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| DGCR8 (go to UniProt):Q8WYQ5 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q8WYQ5 | Domain | 301 | 334 | Note=WW;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00224 | Type=Substitution;Start=303;End=304 |
| Q8WYQ5 | Domain | 301 | 334 | Note=WW;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00224 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Domain | 511 | 578 | Note=DRBM 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00266 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Domain | 511 | 578 | Note=DRBM 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00266 | Type=Deletion;Start=536;End=568 |
| Q8WYQ5 | Domain | 620 | 685 | Note=DRBM 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00266 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 1 | 342 | Note=Necessary for interaction with NCL;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17765891;Dbxref=PMID:17765891 | Type=Substitution;Start=303;End=304 |
| Q8WYQ5 | Region | 1 | 342 | Note=Necessary for interaction with NCL;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17765891;Dbxref=PMID:17765891 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 276 | 751 | Note=Necessary for heme-binding and pri-miRNA processing | Type=Substitution;Start=303;End=304 |
| Q8WYQ5 | Region | 276 | 751 | Note=Necessary for heme-binding and pri-miRNA processing | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 276 | 751 | Note=Necessary for heme-binding and pri-miRNA processing | Type=Deletion;Start=536;End=568 |
| Q8WYQ5 | Region | 360 | 414 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 701 | 773 | Note=Interaction with DROSHA;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:26748718;Dbxref=PMID:26748718 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 742 | 773 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=305;End=773 |
Gene Isoform Structures and Expression Levels for DGCR8 |
| Gene structures of our canonical and alternative spliced genes of DGCR8 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q8WYQ5-1 |
| 3D view using mol* of Q8WYQ5-2 |
| 3D view using mol* of Q8WYQ5-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q8WYQ5-1 |
 |
| pLDDT distribution across the protein length of Q8WYQ5-2 |
 |
| pLDDT distribution across the protein length of Q8WYQ5-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q8WYQ5-1 |
 |
| Ramachandran plot of Q8WYQ5-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q8WYQ5-1 | 0.997 | 144 | 1.021 | 462.021 | 0.587 | 0.686 | 0.854 | 0.371 | 1.013 | 0.367 | 0.869 | 552,553,554,555,556,567,570,571,574,575,581,582,58 5,589,591,592,594,595,616,617,618,630,695,696,697, 698,699,700,701,702,703,704,706 |
| Q8WYQ5-2 | 0.814 | 65 | 0.821 | 214.032 | 0.633 | 0.589 | 0.817 | 0.476 | 0.891 | 0.534 | 0.602 | 118,119,120,121,122,123,124,125,128,132,133,134,13 5,136,137,138,139 |
| Q8WYQ5-3 | 1.089 | 201 | 1.131 | 473.683 | 0.4 | 0.77 | 0.982 | 1.227 | 0.83 | 1.478 | 0.778 | 535,538,539,542,543,594,597,598,599,601,626,627,65 0,651,652,653,654,655,663,664,665,666,667,668,735, 736,737,738,739,740 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q8WYQ5-1_Q8WYQ5-1_6v5b_C.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WYQ5-1_6v5b_C_Q8WYQ5-2.pdb |
| 3D view using mol* of Q8WYQ5-1_6v5b_C_Q8WYQ5-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WYQ5-1_Q8WYQ5-2.pdb |
| 3D view using mol* of Q8WYQ5-1_Q8WYQ5-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q8WYQ5-1_vs_Q8WYQ5-2.png |
 < |
| ./stats/secondary_structure/figure/Q8WYQ5-1_vs_Q8WYQ5-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q8WYQ5-1_vs_Q8WYQ5-2.png |
 < |
| ./stats/relative_asa/Q8WYQ5-1_vs_Q8WYQ5-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q8WYQ5 | Region | 1 | 342 | Note=Necessary for interaction with NCL;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17765891;Dbxref=PMID:17765891 | Type=Substitution;Start=303;End=304 |
| Q8WYQ5 | Region | 1 | 342 | Note=Necessary for interaction with NCL;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17765891;Dbxref=PMID:17765891 | Type=Deletion;Start=305;End=773 |
| Q8WYQ5 | Region | 701 | 773 | Note=Interaction with DROSHA;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:26748718;Dbxref=PMID:26748718 | Type=Deletion;Start=305;End=773 |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to DGCR8 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to DGCR8 |
| Previous studies relating to the alternative splicing of DGCR8 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| DGCR8 | 23863141 | Cellular functions of the microprocessor. | The microprocessor is a complex comprising the RNase III enzyme Drosha and the double-stranded RNA-binding protein DGCR8 (DiGeorge syndrome critical region 8 gene) that catalyses the nuclear step of miRNA (microRNA) biogenesis. DGCR8 recognizes the RNA substrate, whereas Drosha functions as an endonuclease. Recent global analyses of microprocessor and Dicer proteins have suggested novel functions for these components independent of their role in miRNA biogenesis. A HITS-CLIP (high-throughput sequencing of RNA isolated by cross-linking immunoprecipitation) experiment designed to identify novel substrates of the microprocessor revealed that this complex binds and regulates a large variety of cellular RNAs. The microprocessor-mediated cleavage of several classes of RNAs not only regulates transcript levels, but also modulates alternative splicing events, independently of miRNA function. Importantly, DGCR8 can also associate with other nucleases, suggesting the existence of alternative DGCR8 complexes that may regulate the fate of a subset of cellular RNAs. The aim of the present review is to provide an overview of the diverse functional roles of the microprocessor. | D004062 | DiGeorge Syndrome |
Clinically important variants in DGCR8 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |