Protein:PRKCB |
Protein Summary |
 Gene summary |
| Gene name: PRKCB | ASpdb.0 ID: 5579 | Gene | Gene symbol | PRKCB | Gene ID | 5579 |
| Gene name | protein kinase C beta |
| Synonyms | PKC-beta|PKCB|PKCI(2)|PKCbeta|PRKCB1|PRKCB2 |
| Cytomap | 16p12.2-p12.1 |
| Type of gene | protein-coding |
| Description | protein kinase C beta typePKC-Bprotein kinase C, beta 1 polypeptide |
| Modification date | 20240407 |
| UniProtAcc | P05771 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | PRKCB | GO:0003682 | chromatin binding | 20228790 |
| Gene | PRKCB | GO:0004697 | diacylglycerol-dependent serine/threonine kinase activity | 25313067|25982116 |
| Gene | PRKCB | GO:0005634 | nucleus | 20228790 |
| Gene | PRKCB | GO:0005654 | nucleoplasm | - |
| Gene | PRKCB | GO:0005737 | cytoplasm | 15632189 |
| Gene | PRKCB | GO:0005829 | cytosol | - |
| Gene | PRKCB | GO:0005886 | plasma membrane | 15632189 |
| Gene | PRKCB | GO:0010827 | regulation of glucose transmembrane transport | 25982116 |
| Gene | PRKCB | GO:0035403 | histone H3T6 kinase activity | 20228790 |
| Gene | PRKCB | GO:0042393 | histone binding | 20228790 |
| Gene | PRKCB | GO:0043687 | post-translational protein modification | 20228790 |
| Gene | PRKCB | GO:0050681 | nuclear androgen receptor binding | 20228790 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P05771-1 | P05771-1_2i0e_A.pdb | 2I0E | X-ray | 2.6 | A | 339 | 668 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P05771 | PRKCB | P05771-1 | P05771-2 | 671 | 673 | 622 | 671 | Substitution | RDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV | CGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS | 622 | 673 |
| Multiple sequence alignment of our canonical and alternatively spliced PRKCB |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of PRKCB |
| UniProt-id | ENSG | ENST | ENSP |
| P05771-1 | ENSG00000166501.14 | ENST00000321728.12 | ENSP00000318315.7 |
| P05771-2 | ENSG00000166501.14 | ENST00000643927.1 | ENSP00000496129.1 |
| UniProt-id | NM ID | NP ID |
| P05771-1 | NM_212535.2 | NP_997700.1 |
| P05771-2 | NM_002738.6 | NP_002729.2 |
| Amino acid sequences of our canonical and alternatively spliced PRKCB |
| accession_id | Protein sequence |
| P05771-1 | MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGAD KGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAS VDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEI AIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF |
| P05771-2 | MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGAD KGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAS VDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEI AIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFD |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| PRKCB (go to UniProt):P05771 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P05771 | Domain | 601 | 671 | Note=AGC-kinase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00618 | Type=Substitution;Start=622;End=671 |
| P05771 | Region | 614 | 635 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=622;End=671 |
| P05771 | Compositional bias | 614 | 633 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=622;End=671 |
Gene Isoform Structures and Expression Levels for PRKCB |
| Gene structures of our canonical and alternative spliced genes of PRKCB * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P05771-1 |
| 3D view using mol* of P05771-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P05771-1 |
 |
| pLDDT distribution across the protein length of P05771-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P05771-1 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P05771-1 | 1.079 | 136 | 1.121 | 302.183 | 0.473 | 0.759 | 0.941 | 0.839 | 0.842 | 0.996 | 1.589 | 239,261,264,265,266,268,269,271,275,285,286,287,28 8,289,441,445,602,603,604,607,612,613,614,615,616 |
| P05771-2 | 1.046 | 273 | 1.045 | 707.952 | 0.479 | 0.767 | 1.01 | 0.841 | 1.09 | 0.771 | 0.872 | 49,50,51,54,102,109,110,111,113,114,115,116,119,13 1,135,136,137,138,150,151,152,153,154,155,156,157, 158,159,160,276,277,278,279,281,282,286,437,438,43 9,440,441,444,535,563,564,565,566,567,569,598,599, 600,601,602 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P05771-1_P05771-1_2i0e_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P05771-1_2i0e_A_P05771-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P05771-1_P05771-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P05771-1_vs_P05771-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P05771-1_vs_P05771-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to PRKCB |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P05771 | PRKCB | DB01738 | Phosphorylcolamine | experimental | |
| P05771 | PRKCB | DB00163 | Vitamin E | approved, nutraceutical, vet_approved | |
| P05771 | PRKCB | DB08862 | Cholecystokinin | approved, investigational | agonist |
| P05771 | PRKCB | DB06486 | Enzastaurin | investigational | |
| P05771 | PRKCB | DB08846 | Ellagic acid | investigational | inhibitor |
| P05771 | PRKCB | DB14001 | alpha-Tocopherol succinate | approved, nutraceutical, vet_approved | |
| P05771 | PRKCB | DB14002 | D-alpha-Tocopherol acetate | approved, nutraceutical, vet_approved |
Related Diseases to PRKCB |
| Previous studies relating to the alternative splicing of PRKCB and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| PRKCB | 15322124 | Protein kinase CbetaII regulates its own expression in rat intestinal epithelial cells and the colonic epithelium in vivo. | Protein kinase C betaII (PKCbetaII) is induced early during colon carcinogenesis. Transgenic mice expressing elevated PKCbetaII in the colonic epithelium (transgenic PKCbetaII mice) exhibit hyperproliferation and enhanced colon carcinogenesis. Here we demonstrate that nullizygous PKCbeta (PKCbetaKO) mice are highly resistant to azoxymethane (AOM)-induced preneoplastic lesions, aberrant crypt foci. However, reexpression of PKCbetaII in the colon of PKCbetaKO mice by transgenesis restores susceptibility to AOM-induced colon carcinogenesis. Expression of human PKCbetaII in rat intestinal epithelial (RIE) cells induces expression of endogenous rat PKCbetaII mRNA and protein. Induction of PKCbetaII is dependent upon catalytically active PKCbetaII and does not appear to involve changes in alternative splicing of the PKCbeta gene. Two human PKCbeta promoter constructs are activated by expression of PKCbetaII in RIE cells. Both PKCbeta promoter activity and PKCbetaII mRNA levels are inhibited by the MEK1 and -2 inhibitor U0126, but not the Cox-2 inhibitor celecoxib in RIE/PKCbetaII cells. PKCbeta promoter activity correlates directly with expression of endogenous PKCbetaII mRNA and protein in HT29 and HCT116 human colon cancer cell lines. PKCbeta promoter activity and PKCbetaII mRNA expression in HCT116 cells are inhibited by the selective PKCbeta inhibitor LY317615 and by U0126, demonstrating autoregulation of PKCbetaII expression. Transgenic PKCbetaII mice exhibit specific induction of endogenous PKCbetaII, but not its splice variant PKCbetaI, in the colonic epithelium in vivo. Taken together, our results demonstrate that 1) expression of PKCbetaII in the colonic epithelium is both necessary and sufficient to confer susceptibility to AOM-induced colon carcinogenesis in transgenic mice, 2) PKCbetaII regulates its own expression in RIE and human colon cancer cells in vitro and in the colonic epithelium in vivo, and 3) PKCbetaII autoregulation is mediated through a MEK-dependent signaling pathway in RIE/PKCbetaII and HCT116 colon cancer cells. | D003110 | Colonic Neoplasms |
| PRKCB | 18317465 | Involvement of the PRKCB1 gene in autistic disorder: significant genetic association and reduced neocortical gene expression. | Protein kinase C enzymes play an important role in signal transduction, regulation of gene expression and control of cell division and differentiation. The fsI and betaII isoenzymes result from the alternative splicing of the PKCbeta gene (PRKCB1), previously found to be associated with autism. We performed a family-based association study in 229 simplex and 5 multiplex families, and a postmortem study of PRKCB1 gene expression in temporocortical gray matter (BA41/42) of 11 autistic patients and controls. PRKCB1 gene haplotypes are significantly associated with autism (P<0.05) and have the autistic endophenotype of enhanced oligopeptiduria (P<0.05). Temporocortical PRKCB1 gene expression was reduced on average by 35 and 31% for the PRKCB1-1 and PRKCB1-2 isoforms (P<0.01 and <0.05, respectively) according to qPCR. Protein amounts measured for the PKCbetaII isoform were similarly decreased by 35% (P=0.05). Decreased gene expression characterized patients carrying the 'normal' PRKCB1 alleles, whereas patients homozygous for the autism-associated alleles displayed mRNA levels comparable to those of controls. Whole genome expression analysis unveiled a partial disruption in the coordinated expression of PKCbeta-driven genes, including several cytokines. These results confirm the association between autism and PRKCB1 gene variants, point toward PKCbeta roles in altered epithelial permeability, demonstrate a significant downregulation of brain PRKCB1 gene expression in autism and suggest that it could represent a compensatory adjustment aimed at limiting an ongoing dysreactive immune process. Altogether, these data underscore potential PKCbeta roles in autism pathogenesis and spur interest in the identification and functional characterization of PRKCB1 gene variants conferring autism vulnerability. | D020022 | Genetic Predisposition to Disease |
Clinically important variants in PRKCB |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |