Protein:MAVS |
Protein Summary |
 Gene summary |
| Gene name: MAVS | ASpdb.0 ID: 57506 | Gene | Gene symbol | MAVS | Gene ID | 57506 |
| Gene name | mitochondrial antiviral signaling protein |
| Synonyms | CARDIF|IPS-1|IPS1|VISA |
| Cytomap | 20p13 |
| Type of gene | protein-coding |
| Description | mitochondrial antiviral-signaling proteinCARD adapter inducing interferon betaCARD adaptor inducing IFN-betaIFN-B promoter stimulator 1interferon beta promoter stimulator protein 1putative NF-kappa-B-activating protein 031Nvirus-induced signaling ad |
| Modification date | 20240407 |
| UniProtAcc | Q7Z434 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | MAVS | GO:0001934 | positive regulation of protein phosphorylation | 16127453 |
| Gene | MAVS | GO:0002218 | activation of innate immune response | 20628368 |
| Gene | MAVS | GO:0002230 | positive regulation of defense response to virus by host | 16127453|20628368 |
| Gene | MAVS | GO:0002753 | cytoplasmic pattern recognition receptor signaling pathway | 16125763|20451243 |
| Gene | MAVS | GO:0005739 | mitochondrion | 16127453|27992402|31390091 |
| Gene | MAVS | GO:0005739 | mitochondrion | 20628368|23582325 |
| Gene | MAVS | GO:0005741 | mitochondrial outer membrane | 16127453|26314863 |
| Gene | MAVS | GO:0005741 | mitochondrial outer membrane | 18818105 |
| Gene | MAVS | GO:0005778 | peroxisomal membrane | 20451243 |
| Gene | MAVS | GO:0031966 | mitochondrial membrane | 20451243 |
| Gene | MAVS | GO:0032481 | positive regulation of type I interferon production | 16858409 |
| Gene | MAVS | GO:0032727 | positive regulation of interferon-alpha production | 16127453 |
| Gene | MAVS | GO:0032728 | positive regulation of interferon-beta production | 16127453|20628368 |
| Gene | MAVS | GO:0032757 | positive regulation of interleukin-8 production | 16127453 |
| Gene | MAVS | GO:0032760 | positive regulation of tumor necrosis factor production | 16127453 |
| Gene | MAVS | GO:0035591 | signaling adaptor activity | 20451243|23582325|26314863|34880843 |
| Gene | MAVS | GO:0039552 | RIG-I binding | 16127453 |
| Gene | MAVS | GO:0042307 | positive regulation of protein import into nucleus | 18818105 |
| Gene | MAVS | GO:0042802 | identical protein binding | 16127453|26803627 |
| Gene | MAVS | GO:0045071 | negative regulation of viral genome replication | 20451243 |
| Gene | MAVS | GO:0045087 | innate immune response | 23951545 |
| Gene | MAVS | GO:0045944 | positive regulation of transcription by RNA polymerase II | 16127453|18818105 |
| Gene | MAVS | GO:0051091 | positive regulation of DNA-binding transcription factor activity | 16127453|18818105 |
| Gene | MAVS | GO:0051607 | defense response to virus | 20451243 |
| Gene | MAVS | GO:0060090 | molecular adaptor activity | 16858409|20451243 |
| Gene | MAVS | GO:0060340 | positive regulation of type I interferon-mediated signaling pathway | 16127453|20451243 |
| Gene | MAVS | GO:0070585 | protein localization to mitochondrion | 23582325 |
| Gene | MAVS | GO:0071651 | positive regulation of chemokine (C-C motif) ligand 5 production | 16127453 |
| Gene | MAVS | GO:0071660 | positive regulation of IP-10 production | 16127453 |
| Gene | MAVS | GO:0140374 | antiviral innate immune response | 27992402 |
| Gene | MAVS | GO:0140693 | molecular condensate scaffold activity | 27992402 |
| Gene | MAVS | GO:1900227 | positive regulation of NLRP3 inflammasome complex assembly | 23582325 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q7Z434-1 | Q7Z434-1_4p4h_I.pdb | 4P4H | X-ray | 3.4 | I | 1 | 97 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-2 | 540 | 138 | 99 | 131 | Substitution | TSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYN | ERPALALLDPQPAPWPPLSFSLSLYFLPFSVILFLVTVKR | 99 | 138 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-2 | 540 | 138 | 132 | 540 | Deletion | none | none | 138 | 138 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-3 | 540 | 148 | 64 | 148 | Substitution | RRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQ | LPTWAGEETPGGQSSGRGLDFSSLTSGAVWLWQMSDFWSCFSTWTVSIWLILHWVLLRLNLQVFAKCLAQSKWPLLLPSLSCPTW | 64 | 148 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-3 | 540 | 148 | 149 | 540 | Deletion | none | none | 148 | 148 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-4 | 540 | 399 | 1 | 141 | Deletion | none | none | 0 | 0 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-5 | 540 | 124 | 98 | 124 | Substitution | RTSDRPPDPLEPPSLPAERPGPPTPAA | QFRASPADAQPQSHPKESRWWPPGVLL | 98 | 124 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-5 | 540 | 124 | 125 | 540 | Deletion | none | none | 124 | 124 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-6 | 540 | 131 | 40 | 131 | Substitution | DRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYN | GPRTVPQTHWSHRHFLLRGQGPPHLLRPTASPTTAAERRSQVTPCLSRRPRRQSPQERIQSKPCRRSAPEPSQGIQMVAPWSPPLTWQPSAL | 40 | 131 |
| Q7Z434 | MAVS | Q7Z434-1 | Q7Z434-6 | 540 | 131 | 132 | 540 | Deletion | none | none | 131 | 131 |
| Multiple sequence alignment of our canonical and alternatively spliced MAVS |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MAVS |
| UniProt-id | ENSG | ENST | ENSP |
| Q7Z434-1 | ENSG00000088888.18 | ENST00000428216.4 | ENSP00000401980.2 |
| Q7Z434-4 | ENSG00000088888.18 | ENST00000416600.6 | ENSP00000413749.2 |
| UniProt-id | NM ID | NP ID |
| Q7Z434-1 | NM_020746.4 | NP_065797.2 |
| Q7Z434-4 | NM_001206491.1 | NP_001193420.1 |
| Amino acid sequences of our canonical and alternatively spliced MAVS |
| accession_id | Protein sequence |
| Q7Z434-1 | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVAS VYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGK QGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMG PCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH |
| Q7Z434-2 | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVAS |
| Q7Z434-3 | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQLPTWAGEETPGGQSSGRGLDFSSLTSG |
| Q7Z434-4 | MPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLA RSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVST VPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSEN RGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKF |
| Q7Z434-5 | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVAS |
| Q7Z434-6 | MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQGPRTVPQTHWSHRHFLLRGQGPPHLLRPTASPTTAAERRSQVTPCLSRRPR |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| MAVS (go to UniProt):Q7Z434 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Substitution;Start=99;End=131 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Substitution;Start=98;End=124 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Topological domain | 1 | 513 | Note=Cytoplasmic;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Transmembrane | 514 | 534 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Transmembrane | 514 | 534 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Transmembrane | 514 | 534 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Transmembrane | 514 | 534 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Topological domain | 535 | 540 | Note=Mitochondrial intermembrane;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Topological domain | 535 | 540 | Note=Mitochondrial intermembrane;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Topological domain | 535 | 540 | Note=Mitochondrial intermembrane;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Topological domain | 535 | 540 | Note=Mitochondrial intermembrane;Ontology_term=ECO:0000305;evidence=ECO:0000305 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Domain | 10 | 77 | Note=CARD | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Domain | 10 | 77 | Note=CARD | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Domain | 10 | 77 | Note=CARD | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=99;End=131 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=98;End=124 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Region | 95 | 297 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 314 | 358 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 314 | 358 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 314 | 358 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 314 | 358 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 373 | 419 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 373 | 419 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 373 | 419 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 373 | 419 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 476 | 507 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 476 | 507 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 476 | 507 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 476 | 507 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Motif | 439 | 442 | Note=PLxIS motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:25636800;Dbxref=PMID:25636800 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Motif | 439 | 442 | Note=PLxIS motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:25636800;Dbxref=PMID:25636800 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Motif | 439 | 442 | Note=PLxIS motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:25636800;Dbxref=PMID:25636800 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Motif | 439 | 442 | Note=PLxIS motif;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:25636800;Dbxref=PMID:25636800 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 102 | 124 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=99;End=131 |
| Q7Z434 | Compositional bias | 102 | 124 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Compositional bias | 102 | 124 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Compositional bias | 102 | 124 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=98;End=124 |
| Q7Z434 | Compositional bias | 102 | 124 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Compositional bias | 145 | 166 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 145 | 166 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Compositional bias | 145 | 166 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 145 | 166 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 145 | 166 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 184 | 262 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 184 | 262 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 184 | 262 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 184 | 262 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 314 | 350 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 314 | 350 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 314 | 350 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 314 | 350 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 373 | 389 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 373 | 389 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 373 | 389 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 373 | 389 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 400 | 415 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 400 | 415 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 400 | 415 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 400 | 415 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 493 | 507 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Compositional bias | 493 | 507 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Compositional bias | 493 | 507 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Compositional bias | 493 | 507 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=132;End=540 |
Gene Isoform Structures and Expression Levels for MAVS |
| Gene structures of our canonical and alternative spliced genes of MAVS * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q7Z434-1 |
| 3D view using mol* of Q7Z434-2 |
| 3D view using mol* of Q7Z434-3 |
| 3D view using mol* of Q7Z434-4 |
| 3D view using mol* of Q7Z434-5 |
| 3D view using mol* of Q7Z434-6 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q7Z434-1 |
 |
| pLDDT distribution across the protein length of Q7Z434-2 |
 |
| pLDDT distribution across the protein length of Q7Z434-3 |
 |
| pLDDT distribution across the protein length of Q7Z434-4 |
 |
| pLDDT distribution across the protein length of Q7Z434-5 |
 |
| pLDDT distribution across the protein length of Q7Z434-6 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q7Z434-1 |
 |
| Ramachandran plot of Q7Z434-2 |
 |
| Ramachandran plot of Q7Z434-5 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q7Z434-1 | 0.425 | 8 | 0.314 | 33.271 | 0.8 | 0.6 | 1.025 | 0.337 | 0.958 | 0.352 | 1.027 | 7,10,11,14,95
|
| Q7Z434-2 | 0.695 | 31 | 0.659 | 74.088 | 0.544 | 0.655 | 0.994 | 0.697 | 0.792 | 0.88 | 0.54 | 38,41,42,45,57,60,61,64
|
| Q7Z434-3 | 1.071 | 284 | 1.142 | 770.378 | 0.56 | 0.694 | 0.904 | 1.57 | 0.658 | 2.386 | 0.781 | 5,8,9,11,12,13,15,16,19,22,27,30,31,33,34,35,38,41 ,42,45,54,55,56,57,58,59,60,61,62,63,64,65,66,74,7 5,76,77,78,79,80,81,82,83,84,85,87,88,91,92,95,96, 99 |
| Q7Z434-4 | 0.327 | 2 | 0.24 | 6.517 | 0.923 | 0.508 | 0.831 | 0.366 | 0.607 | 0.603 | 0.526 | 358,360,361
|
| Q7Z434-5 | 0.58 | 21 | 0.461 | 75.803 | 0.667 | 0.663 | 1.013 | 0.814 | 1.13 | 0.72 | 0.751 | 38,41,42,57,60,61,64
|
| Q7Z434-6 | 1.005 | 120 | 1.071 | 400.967 | 0.733 | 0.618 | 0.775 | 0.587 | 0.735 | 0.799 | 0.941 | 1,5,6,9,13,16,24,25,27,28,31,34,35,37,38,40,41,42, 49,51,53,54,55,57,59,60,61,62,63,64,65,66,67 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q7Z434-1_Q7Z434-1_4p4h_I.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q7Z434-1_4p4h_I_Q7Z434-2.pdb |
| 3D view using mol* of Q7Z434-1_4p4h_I_Q7Z434-3.pdb |
| 3D view using mol* of Q7Z434-1_4p4h_I_Q7Z434-4.pdb |
| 3D view using mol* of Q7Z434-1_4p4h_I_Q7Z434-5.pdb |
| 3D view using mol* of Q7Z434-1_4p4h_I_Q7Z434-6.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q7Z434-1_Q7Z434-2.pdb |
| 3D view using mol* of Q7Z434-1_Q7Z434-3.pdb |
| 3D view using mol* of Q7Z434-1_Q7Z434-4.pdb |
| 3D view using mol* of Q7Z434-1_Q7Z434-5.pdb |
| 3D view using mol* of Q7Z434-1_Q7Z434-6.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q7Z434-1_vs_Q7Z434-2.png |
 < |
| ./stats/secondary_structure/figure/Q7Z434-1_vs_Q7Z434-3.png |
 < |
| ./stats/secondary_structure/figure/Q7Z434-1_vs_Q7Z434-4.png |
 < |
| ./stats/secondary_structure/figure/Q7Z434-1_vs_Q7Z434-5.png |
 < |
| ./stats/secondary_structure/figure/Q7Z434-1_vs_Q7Z434-6.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q7Z434-1_vs_Q7Z434-2.png |
 < |
| ./stats/relative_asa/Q7Z434-1_vs_Q7Z434-3.png |
 < |
| ./stats/relative_asa/Q7Z434-1_vs_Q7Z434-4.png |
 < |
| ./stats/relative_asa/Q7Z434-1_vs_Q7Z434-5.png |
 < |
| ./stats/relative_asa/Q7Z434-1_vs_Q7Z434-6.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Deletion;Start=1;End=141 |
| Q7Z434 | Region | 10 | 77 | Note=Required for interaction with NLRX1;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:18200010;Dbxref=PMID:18200010 | Type=Substitution;Start=40;End=131 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Substitution;Start=64;End=148 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 143 | 147 | Note=Interaction with TRAF2;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16153868;Dbxref=PMID:16153868 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 153 | 158 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=149;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=125;End=540 |
| Q7Z434 | Region | 455 | 460 | Note=Interaction with TRAF6 | Type=Deletion;Start=132;End=540 |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MAVS |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to MAVS |
| Previous studies relating to the alternative splicing of MAVS and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MAVS | 18977754 | Negative regulation of virus-triggered IFN-beta signaling pathway by alternative splicing of TBK1. | Induction of Type I IFNs is a central event in antiviral responses and must be tightly controlled. The protein kinase TBK1 is critically involved in virus-triggered type I IFN signaling. In this study, we identify an alternatively spliced isoform of TBK1, termed TBK1s, which lacks exons 3-6. Upon Sendai virus (SeV) infection, TBK1s is induced in both human and mouse cells and binds to RIG-1, disrupting the interaction between RIG-I and VISA. Consistent with that result, overexpression of TBK1s inhibits IRF3 nuclear translocation and leads to a shutdown of SeV-triggered IFN-beta production. Taken together, our data indicate that TBK1s plays an inhibitory role in virus-triggered IFN-beta signaling pathways. | D010253 | Respirovirus Infections |
Clinically important variants in MAVS |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |