Protein:RELA |
Protein Summary |
 Gene summary |
| Gene name: RELA | ASpdb.0 ID: 5970 | Gene | Gene symbol | RELA | Gene ID | 5970 |
| Gene name | RELA proto-oncogene, NF-kB subunit |
| Synonyms | AIF3BL3|CMCU|NFKB3|p65 |
| Cytomap | 11q13.1 |
| Type of gene | protein-coding |
| Description | transcription factor p65NF-kappa-B p65delta3NF-kappa-B transcription factor p65nuclear factor NF-kappa-B p65 subunitnuclear factor of kappa light polypeptide gene enhancer in B-cells 3v-rel avian reticuloendotheliosis viral oncogene homolog A |
| Modification date | 20240416 |
| UniProtAcc | Q04206 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | RELA | GO:0000122 | negative regulation of transcription by RNA polymerase II | 17350185 |
| Gene | RELA | GO:0000785 | chromatin | 1406630|8413223|21343296|26268439 |
| Gene | RELA | GO:0000976 | transcription cis-regulatory region binding | 17350185 |
| Gene | RELA | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding | 7959007|24955228|25411248 |
| Gene | RELA | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 1406630|17350185|23729669|23811396|23878390 |
| Gene | RELA | GO:0000979 | RNA polymerase II core promoter sequence-specific DNA binding | 21343296 |
| Gene | RELA | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific | 3091258|21343177|23878390 |
| Gene | RELA | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific | 17350185 |
| Gene | RELA | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific | 1406630|17350185|23811396|26435691 |
| Gene | RELA | GO:0002357 | defense response to tumor cell | 28362429 |
| Gene | RELA | GO:0003677 | DNA binding | 15790681|18073330|23091055 |
| Gene | RELA | GO:0003682 | chromatin binding | 19058135 |
| Gene | RELA | GO:0003700 | DNA-binding transcription factor activity | 8413223|12048232|19103749 |
| Gene | RELA | GO:0005634 | nucleus | 1493333 |
| Gene | RELA | GO:0005634 | nucleus | 3140380|15790681|17350185|18045535|18212740|19058135|21097510|21343177|21343296|21474709|21830064|22065573|25411248 |
| Gene | RELA | GO:0005667 | transcription regulator complex | 12048232 |
| Gene | RELA | GO:0005730 | nucleolus | 21343177 |
| Gene | RELA | GO:0005737 | cytoplasm | 3140380|15790681|21097510|21343177|21830064|25411248|27736973 |
| Gene | RELA | GO:0005829 | cytosol | 21474709|25327529 |
| Gene | RELA | GO:0006357 | regulation of transcription by RNA polymerase II | 1406630 |
| Gene | RELA | GO:0006954 | inflammatory response | 12924514 |
| Gene | RELA | GO:0007249 | canonical NF-kappaB signal transduction | 1406630|21343177|23811396|23878390 |
| Gene | RELA | GO:0008284 | positive regulation of cell population proliferation | 23091055 |
| Gene | RELA | GO:0010033 | response to organic substance | 10747850 |
| Gene | RELA | GO:0010224 | response to UV-B | 15616591 |
| Gene | RELA | GO:0019221 | cytokine-mediated signaling pathway | 15876188 |
| Gene | RELA | GO:0031490 | chromatin DNA binding | 25411248 |
| Gene | RELA | GO:0032731 | positive regulation of interleukin-1 beta production | 27203220 |
| Gene | RELA | GO:0032755 | positive regulation of interleukin-6 production | 27203220 |
| Gene | RELA | GO:0032757 | positive regulation of interleukin-8 production | 27203220 |
| Gene | RELA | GO:0033209 | tumor necrosis factor-mediated signaling pathway | 21343177|25411248 |
| Gene | RELA | GO:0034142 | toll-like receptor 4 signaling pathway | 25355951 |
| Gene | RELA | GO:0035525 | NF-kappaB p50/p65 complex | 18045535 |
| Gene | RELA | GO:0035556 | intracellular signal transduction | 27203220 |
| Gene | RELA | GO:0038061 | non-canonical NF-kappaB signal transduction | 8413223|12048232 |
| Gene | RELA | GO:0042301 | phosphate ion binding | 10521409 |
| Gene | RELA | GO:0042802 | identical protein binding | 9437432 |
| Gene | RELA | GO:0042803 | protein homodimerization activity | 18045535|18212740 |
| Gene | RELA | GO:0043066 | negative regulation of apoptotic process | 10747850|23091055 |
| Gene | RELA | GO:0045892 | negative regulation of DNA-templated transcription | 17350185 |
| Gene | RELA | GO:0045893 | positive regulation of DNA-templated transcription | 17350185|18073330 |
| Gene | RELA | GO:0045944 | positive regulation of transcription by RNA polymerase II | 1406630|8246997|17350185|23091055|23811396|26435691 |
| Gene | RELA | GO:0051092 | positive regulation of NF-kappaB transcription factor activity | 15790681 |
| Gene | RELA | GO:0070301 | cellular response to hydrogen peroxide | 21830064 |
| Gene | RELA | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway | 12527755 |
| Gene | RELA | GO:0071347 | cellular response to interleukin-1 | 18073330 |
| Gene | RELA | GO:0071356 | cellular response to tumor necrosis factor | 18073330|23091055 |
| Gene | RELA | GO:0098978 | glutamatergic synapse | 12947408 |
| Gene | RELA | GO:0099527 | postsynapse to nucleus signaling pathway | 12947408 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q04206-1 | Q04206-1_1nfi_C.pdb | 1NFI | X-ray | 2.7 | C | 20 | 320 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q04206 | RELA | Q04206-1 | Q04206-2 | 551 | 537 | 13 | 25 | Deletion | none | none | 12 | 12 |
| Q04206 | RELA | Q04206-1 | Q04206-2 | 551 | 537 | 506 | 506 | Deletion | none | none | 492 | 492 |
| Q04206 | RELA | Q04206-1 | Q04206-3 | 551 | 541 | 222 | 231 | Deletion | none | none | 221 | 221 |
| Q04206 | RELA | Q04206-1 | Q04206-4 | 551 | 548 | 143 | 145 | Deletion | none | none | 142 | 142 |
| Multiple sequence alignment of our canonical and alternatively spliced RELA |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of RELA |
| UniProt-id | ENSG | ENST | ENSP |
| Q04206-1 | ENSG00000173039.20 | ENST00000406246.8 | ENSP00000384273.3 |
| Q04206-4 | ENSG00000173039.20 | ENST00000308639.13 | ENSP00000311508.9 |
| UniProt-id | NM ID | NP ID |
| Q04206-1 | NM_021975.3 | NP_068810.3 |
| Q04206-4 | NM_001145138.1 | NP_001138610.1 |
| Amino acid sequences of our canonical and alternatively spliced RELA |
| accession_id | Protein sequence |
| Q04206-1 | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHEL VGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSM QLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDL GALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM |
| Q04206-2 | MDELFPLIFPAEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAE LCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAE LKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEP MEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQI SQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVF |
| Q04206-3 | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHEL VGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPS GQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDP AVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS |
| Q04206-4 | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHEL VGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPI FDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLR RPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEF PTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGAL LGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFS |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| RELA (go to UniProt):Q04206 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q04206 | Domain | 19 | 306 | Note=RHD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00265 | Type=Deletion;Start=13;End=25 |
| Q04206 | Domain | 19 | 306 | Note=RHD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00265 | Type=Deletion;Start=222;End=231 |
| Q04206 | Domain | 19 | 306 | Note=RHD;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00265 | Type=Deletion;Start=143;End=145 |
| Q04206 | Region | 506 | 530 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=506;End=506 |
Gene Isoform Structures and Expression Levels for RELA |
| Gene structures of our canonical and alternative spliced genes of RELA * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q04206-1 |
| 3D view using mol* of Q04206-2 |
| 3D view using mol* of Q04206-3 |
| 3D view using mol* of Q04206-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q04206-1 |
 |
| pLDDT distribution across the protein length of Q04206-2 |
 |
| pLDDT distribution across the protein length of Q04206-3 |
 |
| pLDDT distribution across the protein length of Q04206-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q04206-1 |
 |
| Ramachandran plot of Q04206-2 |
 |
| Ramachandran plot of Q04206-4 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q04206-1 | 0.91 | 88 | 0.91 | 221.235 | 0.567 | 0.631 | 0.925 | 0.363 | 1.077 | 0.337 | 0.703 | 69,70,71,72,73,101,137,138,139,140,142,162,163,164 ,166,172,174,175,177 |
| Q04206-2 | 0.884 | 78 | 0.857 | 171.5 | 0.487 | 0.653 | 0.949 | 0.463 | 1.121 | 0.413 | 0.826 | 58,59,60,88,124,125,126,127,129,149,150,151,159,16 1,162,164 |
| Q04206-3 | 1.085 | 139 | 1.105 | 246.96 | 0.338 | 0.807 | 1.128 | 1.453 | 0.979 | 1.484 | 0.749 | 196,212,214,223,224,225,226,227,229,240,242,244,24 5,247,258,259,260,261,262,263,270,276,278 |
| Q04206-4 | 0.802 | 60 | 0.759 | 149.548 | 0.559 | 0.649 | 0.992 | 0.517 | 1.098 | 0.47 | 0.949 | 21,71,72,73,101,138,139,140,142,158,159,160,161,17 1,172,173,174 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q04206-1_Q04206-1_1nfi_C.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q04206-1_1nfi_C_Q04206-2.pdb |
| 3D view using mol* of Q04206-1_1nfi_C_Q04206-3.pdb |
| 3D view using mol* of Q04206-1_1nfi_C_Q04206-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q04206-1_Q04206-2.pdb |
| 3D view using mol* of Q04206-1_Q04206-3.pdb |
| 3D view using mol* of Q04206-1_Q04206-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q04206-1_vs_Q04206-2.png |
 < |
| ./stats/secondary_structure/figure/Q04206-1_vs_Q04206-3.png |
 < |
| ./stats/secondary_structure/figure/Q04206-1_vs_Q04206-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q04206-1_vs_Q04206-2.png |
 < |
| ./stats/relative_asa/Q04206-1_vs_Q04206-3.png |
 < |
| ./stats/relative_asa/Q04206-1_vs_Q04206-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to RELA |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| Q04206 | RELA | DB08908 | Dimethyl fumarate | approved, investigational | inhibitor, binder |
| Q04206 | RELA | DB01296 | Glucosamine | approved, investigational | inhibitor |
Related Diseases to RELA |
| Previous studies relating to the alternative splicing of RELA and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| RELA | 8281153 | Genomic organization of the gene encoding the p65 subunit of NF-kappa B: multiple variants of the p65 protein may be generated by alternative splicing. | Transcription factor NF-kappa B represents a family of closely related homo- and heterodimeric factors. The most abundant form of NF-kappa B is the p50/p65 heterodimer. We determined the complete genomic structure of the human gene and a partial structure of the mouse gene encoding p65. The human gene consists of ten exons and spans about 8.1 kbp of DNA. The exon-intron organization in the rel homology domain (exons 2 to 7) is conserved when compared to human and turkey c-rel, strengthening the evolutionary relationship between p65 and c-rel. The lengths of the corresponding introns 5 and 6 in the human and mouse p65 genes are not conserved. However, a surprisingly high degree of conservation of intron sequences was observed between both species. We show that the naturally occurring shorter variant of p65 (p65 delta) can be generated by alternative splicing of intron 6, not only in humans but also in mouse. In addition, the existence of another, as yet unknown splice variant of p65 is predicted. | D015473 | Leukemia, Promyelocytic, Acute |
| RELA | 8543190 | A novel NF-kappa B p65 spliced transcript lacking exons 6 and 7 in a non-small cell lung carcinoma cell line. | Transcripts of the gene encoding the p65 subunit of the NF-kappa B/Rel transcription factor complex have been reported to undergo alternative splicing to generate one derivative lacking codons for amino acids (aa) 222 to 231 (p65 delta 1) and another that lacks codons for aa 13 to 25 (p65 delta 2) of the conserved Rel homology domain [Narayaran et al., Science 256 (1992) 317-320; Lyle et al., Gene 138 (1994) 265-266]. We have identified a third splicing event in a non-small-cell lung carcinoma cell line that potentially generates a novel p65 mRNA derivative lacking codons for aa 187 to 293 (p65 delta 3) of the Rel homology domain. | D002277 | Carcinoma |
| RELA | 8543190 | A novel NF-kappa B p65 spliced transcript lacking exons 6 and 7 in a non-small cell lung carcinoma cell line. | Transcripts of the gene encoding the p65 subunit of the NF-kappa B/Rel transcription factor complex have been reported to undergo alternative splicing to generate one derivative lacking codons for amino acids (aa) 222 to 231 (p65 delta 1) and another that lacks codons for aa 13 to 25 (p65 delta 2) of the conserved Rel homology domain [Narayaran et al., Science 256 (1992) 317-320; Lyle et al., Gene 138 (1994) 265-266]. We have identified a third splicing event in a non-small-cell lung carcinoma cell line that potentially generates a novel p65 mRNA derivative lacking codons for aa 187 to 293 (p65 delta 3) of the Rel homology domain. | D002289 | Carcinoma, Non-Small-Cell Lung |
| RELA | 8543190 | A novel NF-kappa B p65 spliced transcript lacking exons 6 and 7 in a non-small cell lung carcinoma cell line. | Transcripts of the gene encoding the p65 subunit of the NF-kappa B/Rel transcription factor complex have been reported to undergo alternative splicing to generate one derivative lacking codons for amino acids (aa) 222 to 231 (p65 delta 1) and another that lacks codons for aa 13 to 25 (p65 delta 2) of the conserved Rel homology domain [Narayaran et al., Science 256 (1992) 317-320; Lyle et al., Gene 138 (1994) 265-266]. We have identified a third splicing event in a non-small-cell lung carcinoma cell line that potentially generates a novel p65 mRNA derivative lacking codons for aa 187 to 293 (p65 delta 3) of the Rel homology domain. | D008175 | Lung Neoplasms |
Clinically important variants in RELA |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |