Protein:SET |
Protein Summary |
Gene summary |
| Gene name: SET | ASpdb.0 ID: 6418 | Gene | Gene symbol | SET | Gene ID | 6418 |
| Gene name | SET nuclear proto-oncogene |
| Synonyms | 2PP2A|I2PP2A|IGAAD|IPP2A2|MRD58|PHAPII|TAF-I|TAF-IBETA |
| Cytomap | 9q34.11 |
| Type of gene | protein-coding |
| Description | protein SETHLA-DR-associated protein IISET nuclear oncogeneSET translocation (myeloid leukemia-associated)Template-Activating Factor-I, chromatin remodelling factorchromatin remodelling factorinhibitor of granzyme A-activated DNaseinhibitor-2 of pr |
| Modification date | 20240403 |
| UniProtAcc | Q01105 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | SET | GO:0005634 | nucleus | 11555662 |
| Gene | SET | GO:0005654 | nucleoplasm | - |
| Gene | SET | GO:0005737 | cytoplasm | 11909973|12524539 |
| Gene | SET | GO:0005783 | endoplasmic reticulum | 11555662|12524539 |
| Gene | SET | GO:0005811 | lipid droplet | - |
| Gene | SET | GO:0032991 | protein-containing complex | 11909973 |
| Gene | SET | GO:0045892 | negative regulation of DNA-templated transcription | 19343227 |
| Gene | SET | GO:0048471 | perinuclear region of cytoplasm | 11555662|12524539 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q01105-1 | Q01105-1_2e50_B.pdb | 2E50 | X-ray | 2.3 | B | 38 | 236 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q01105 | SET | Q01105-1 | Q01105-2 | 290 | 277 | 1 | 37 | Substitution | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKG | MSAPAAKVSKKELNSNHDGADETS | 1 | 24 |
| Q01105 | SET | Q01105-1 | Q01105-3 | 290 | 265 | 1 | 37 | Substitution | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKG | MPRSHQPPPPPH | 1 | 12 |
| Q01105 | SET | Q01105-1 | Q01105-4 | 290 | 268 | 1 | 37 | Substitution | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKG | MGCRDLLPSLKPTLL | 1 | 15 |
Multiple sequence alignment of our canonical and alternatively spliced SET |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of SET |
| UniProt-id | ENSG | ENST | ENSP |
| Q01105-1 | ENSG00000119335.18 | ENST00000372692.8 | ENSP00000361777.4 |
| Q01105-1 | ENSG00000119335.18 | ENST00000686840.1 | ENSP00000509032.1 |
| Q01105-2 | ENSG00000119335.18 | ENST00000322030.13 | ENSP00000318012.9 |
| Q01105-4 | ENSG00000119335.18 | ENST00000409104.7 | ENSP00000387321.3 |
| UniProt-id | NM ID | NP ID |
| Q01105-1 | NM_001122821.1 | NP_001116293.1 |
| Q01105-2 | NM_003011.3 | NP_003002.2 |
| Q01105-4 | NM_001248000.1 | NP_001234929.1 |
Amino acid sequences of our canonical and alternatively spliced SET |
| accession_id | Protein sequence |
| Q01105-1 | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAK IPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLT KRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEG |
| Q01105-2 | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHP QVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRK RQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGE |
| Q01105-3 | MPRSHQPPPPPHEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEE ALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTW |
| Q01105-4 | MGCRDLLPSLKPTLLEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEE DEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESF |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| SET (go to UniProt):Q01105 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q01105 | Region | 1 | 45 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=1;End=37 |
| Q01105 | Region | 1 | 45 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=1;End=37 |
| Q01105 | Region | 1 | 45 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=1;End=37 |
| Q01105 | Region | 31 | 78 | Note=Dimerization | Type=Substitution;Start=1;End=37 |
| Q01105 | Region | 31 | 78 | Note=Dimerization | Type=Substitution;Start=1;End=37 |
| Q01105 | Region | 31 | 78 | Note=Dimerization | Type=Substitution;Start=1;End=37 |
Gene Isoform Structures and Expression Levels for SET |
Gene structures of our canonical and alternative spliced genes of SET* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q01105-1 |
| 3D view using mol* of Q01105-2 |
| 3D view using mol* of Q01105-3 |
| 3D view using mol* of Q01105-4 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q01105-1 |
![]() |
| Ramachandran plot of Q01105-4 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q01105-1 | 0.998 | 246 | 1.012 | 869.505 | 0.582 | 0.695 | 0.893 | 0.409 | 1.059 | 0.386 | 1.033 | 2,3,4,5,7,8,9,10,11,12,13,14,56,59,60,63,66,67,69, 70,71,73,74,75,77,78,81,125,126,127,128,129,131,13 2,134,135,156,157,158,164,165,212,213,215,219,222, 223,224,226,227,228,231 |
| Q01105-2 | 1.013 | 145 | 0.976 | 274.4 | 0.415 | 0.718 | 0.999 | 0.523 | 1.211 | 0.432 | 1.556 | 57,58,61,62,64,65,68,69,111,112,113,114,115,116,11 8,209,210,213,214 |
| Q01105-3 | 1.011 | 128 | 1.02 | 280.574 | 0.455 | 0.714 | 0.995 | 0.618 | 1.068 | 0.578 | 1.64 | 46,49,50,52,53,56,57,60,99,100,101,102,103,104,105 ,106,197,198,201,202 |
| Q01105-4 | 0.991 | 101 | 1.014 | 299.096 | 0.648 | 0.679 | 0.895 | 0.276 | 1.025 | 0.27 | 1.808 | 48,49,52,53,55,56,59,103,104,105,106,107,109,112,1 13,134,135,136,142,143,190,191,193,197,200,201,204 ,205 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q01105-1_Q01105-1_2e50_B.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q01105-1_2e50_B_Q01105-2.pdb |
| 3D view using mol* of Q01105-1_2e50_B_Q01105-3.pdb |
| 3D view using mol* of Q01105-1_2e50_B_Q01105-4.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q01105-1_Q01105-2.pdb |
| 3D view using mol* of Q01105-1_Q01105-3.pdb |
| 3D view using mol* of Q01105-1_Q01105-4.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q01105-1_vs_Q01105-2.png |
< |
| ./stats/secondary_structure/figure/Q01105-1_vs_Q01105-3.png |
< |
| ./stats/secondary_structure/figure/Q01105-1_vs_Q01105-4.png |
< |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q01105-1_vs_Q01105-2.png |
< |
| ./stats/relative_asa/Q01105-1_vs_Q01105-3.png |
< |
| ./stats/relative_asa/Q01105-1_vs_Q01105-4.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to SET |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to SET |
Previous studies relating to the alternative splicing of SET and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| SET | 19166587 | SET-NUP214 fusion in acute myeloid leukemia- and T-cell acute lymphoblastic leukemia-derived cell lines. | SET-NUP214 fusion resulting from a recurrent cryptic deletion, del(9)(q34.11q34.13) has recently been described in T-cell acute lymphoblastic leukemia (T-ALL) and in one case of acute myeloid leukemia (AML). The fusion protein appears to promote elevated expression of HOXA cluster genes in T-ALL and may contribute to the pathogenesis of the disease. We screened a panel of ALL and AML cell lines for SET-NUP214 expression to find model systems that might help to elucidate the cellular function of this fusion gene. | D015470 | Leukemia, Myeloid, Acute |
| SET | 19166587 | SET-NUP214 fusion in acute myeloid leukemia- and T-cell acute lymphoblastic leukemia-derived cell lines. | SET-NUP214 fusion resulting from a recurrent cryptic deletion, del(9)(q34.11q34.13) has recently been described in T-cell acute lymphoblastic leukemia (T-ALL) and in one case of acute myeloid leukemia (AML). The fusion protein appears to promote elevated expression of HOXA cluster genes in T-ALL and may contribute to the pathogenesis of the disease. We screened a panel of ALL and AML cell lines for SET-NUP214 expression to find model systems that might help to elucidate the cellular function of this fusion gene. | D054218 | Precursor T-Cell Lymphoblastic Leukemia-Lymphoma |
Clinically important variants in SET |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|