Protein:TACR1 |
Protein Summary |
 Gene summary |
| Gene name: TACR1 | ASpdb.0 ID: 6869 | Gene | Gene symbol | TACR1 | Gene ID | 6869 |
| Gene name | tachykinin receptor 1 |
| Synonyms | NK1R|NKIR|SPR|TAC1R |
| Cytomap | 2p12 |
| Type of gene | protein-coding |
| Description | substance-P receptorNK-1 receptorNK-1Rneurokinin receptor 1tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor) |
| Modification date | 20240305 |
| UniProtAcc | P25103 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | TACR1 | GO:0005886 | plasma membrane | 17986524 |
| Gene | TACR1 | GO:0007204 | positive regulation of cytosolic calcium ion concentration | 12716968 |
| Gene | TACR1 | GO:0007217 | tachykinin receptor signaling pathway | 17986524 |
| Gene | TACR1 | GO:0036126 | sperm flagellum | 17437961 |
| Gene | TACR1 | GO:0061827 | sperm head | 17437961 |
| Gene | TACR1 | GO:0097225 | sperm midpiece | 17437961 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P25103-1 | P25103-1_6hlp_A.pdb | 6HLP | X-ray | 2.2 | A | 238 | 327 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P25103 | TACR1 | P25103-1 | P25103-3 | 407 | 311 | 312 | 407 | Deletion | none | none | 311 | 311 |
| Multiple sequence alignment of our canonical and alternatively spliced TACR1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of TACR1 |
| UniProt-id | ENSG | ENST | ENSP |
| P25103-1 | ENSG00000115353.11 | ENST00000305249.10 | ENSP00000303522.4 |
| P25103-3 | ENSG00000115353.11 | ENST00000409848.3 | ENSP00000386448.3 |
| UniProt-id | NM ID | NP ID |
| P25103-1 | NM_001058.3 | NP_001049.1 |
| P25103-3 | NM_015727.2 | NP_056542.1 |
| Amino acid sequences of our canonical and alternatively spliced TACR1 |
| accession_id | Protein sequence |
| P25103-1 | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNF TYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLL PYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST |
| P25103-3 | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNF TYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| TACR1 (go to UniProt):P25103 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P25103 | Topological domain | 309 | 407 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=312;End=407 |
| P25103 | Region | 364 | 407 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=312;End=407 |
| P25103 | Compositional bias | 377 | 407 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=312;End=407 |
Gene Isoform Structures and Expression Levels for TACR1 |
| Gene structures of our canonical and alternative spliced genes of TACR1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P25103-1 |
| 3D view using mol* of P25103-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P25103-1 |
 |
| pLDDT distribution across the protein length of P25103-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P25103-1 |
 |
| Ramachandran plot of P25103-3 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P25103-1 | 1.076 | 303 | 1.047 | 806.393 | 0.478 | 0.811 | 1.043 | 0.864 | 1.165 | 0.742 | 1.055 | 1,2,3,4,5,6,7,25,85,89,92,93,96,108,109,112,113,11 6,165,172,180,181,182,183,184,185,186,187,190,191, 192,193,196,197,200,201,204,261,264,265,267,268,27 1,272,275,278,279,283,284,287,291,294,295 |
| P25103-3 | 1.134 | 163 | 1.188 | 644.154 | 0.573 | 0.809 | 0.953 | 1.189 | 0.728 | 1.632 | 1.763 | 25,89,92,93,96,108,109,112,113,116,165,180,181,182 ,184,193,196,197,200,201,204,261,264,265,267,268,2 71,272,278,283,284,287,291,295 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P25103-1_P25103-1_6hlp_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P25103-1_6hlp_A_P25103-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P25103-1_P25103-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P25103-1_vs_P25103-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P25103-1_vs_P25103-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to TACR1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P25103 | TACR1 | DB01221 | Ketamine | approved, vet_approved | antagonist |
| P25103 | TACR1 | DB04894 | Vapreotide | experimental, investigational | antagonist |
| P25103 | TACR1 | DB05418 | GW 597599 | investigational | |
| P25103 | TACR1 | DB05072 | AV608 | investigational | |
| P25103 | TACR1 | DB05421 | CP-122721 | investigational | |
| P25103 | TACR1 | DB09291 | Rolapitant | approved, investigational | antagonist |
| P25103 | TACR1 | DB05466 | R673 | investigational | |
| P25103 | TACR1 | DB06634 | Casopitant | investigational | |
| P25103 | TACR1 | DB14019 | Fosnetupitant | approved | antagonist |
| P25103 | TACR1 | DB00673 | Aprepitant | approved, investigational | antagonist |
| P25103 | TACR1 | DB00193 | Tramadol | approved, investigational | inhibitor |
| P25103 | TACR1 | DB09048 | Netupitant | approved, investigational | antagonist |
| P25103 | TACR1 | DB11949 | Vestipitant | investigational | |
| P25103 | TACR1 | DB05790 | SR 140333 | investigational | |
| P25103 | TACR1 | DB12436 | Vofopitant | investigational |
Related Diseases to TACR1 |
| Previous studies relating to the alternative splicing of TACR1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| TACR1 | 22057425 | Detection of the full-length transcript variant for neurokinin-1 receptor in human whole blood associated with enhanced reinforcement of clot by substance-P. | We have recently reported that a neurotransmitter for pain, substance-P (SP), promotes platelet-dependent clot formation through neurokinin-1 receptors (NK1Rs), in which leukocytes appear to be involved (J Thromb Thrombolysis 2009;27:280-6). Two naturally occurring splice isoforms of NK1R with different signal transduction potency, namely the full-length and the truncated NK1Rs are identified. It is known that human leukocytes express truncated NK1Rs, while in vivo expression of the full-length NK1R has not yet been fully clarified. Modulatory effects of alternative splicing for NK1Rs on clot formation also remain to be evaluated. Expression of the transcript variant mRNA for NK1Rs in human whole blood (n = 20) was evaluated by real-time reverse transcription polymerase chain reaction (RT-PCR). A 15 min time series of the strength of clot, formed after reloading of calcium in citrated whole blood with or without SP (10 nM) and a NK1R antagonist Spantide (1 μM), was measured by using oscillating-probe viscoelastometry. The full-length transcript variant was detected in 5 samples among 20. SP significantly increased the clot strength while Spantide suppressed the SP-derived change. The extent of modulation by SP/NK1R pathway in a subgroup with expression of the full-length transcript variant was three times as potent as those in another subgroup without expression. We conclude that expression of the full-length transcript variant for NK1R can be detected in human whole blood and that such expression is associated with the enhanced reinforcement of clot by SP. Further study is required to nominate this mRNA as a biomarker for prothrombotic risks in painful conditions such as perioperative period. | D013927 | Thrombosis |
Clinically important variants in TACR1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |