Protein:MAP3K7 |
Protein Summary |
Gene summary |
| Gene name: MAP3K7 | ASpdb.0 ID: 6885 | Gene | Gene symbol | MAP3K7 | Gene ID | 6885 |
| Gene name | mitogen-activated protein kinase kinase kinase 7 |
| Synonyms | CSCF|FMD2|MEKK7|TAK1|TGF1a |
| Cytomap | 6q15 |
| Type of gene | protein-coding |
| Description | mitogen-activated protein kinase kinase kinase 7TGF-beta activated kinase 1transforming growth factor-beta-activated kinase 1 |
| Modification date | 20240408 |
| UniProtAcc | O43318 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | MAP3K7 | GO:0000165 | MAPK cascade | 8663074|11865055 |
| Gene | MAP3K7 | GO:0004674 | protein serine/threonine kinase activity | 10094049|10702308|11460167|37832545 |
| Gene | MAP3K7 | GO:0004707 | MAP kinase activity | 11865055 |
| Gene | MAP3K7 | GO:0004709 | MAP kinase kinase kinase activity | 8663074|9079627|11460167 |
| Gene | MAP3K7 | GO:0005737 | cytoplasm | 12242293 |
| Gene | MAP3K7 | GO:0005829 | cytosol | 12242293 |
| Gene | MAP3K7 | GO:0005829 | cytosol | - |
| Gene | MAP3K7 | GO:0005886 | plasma membrane | - |
| Gene | MAP3K7 | GO:0006954 | inflammatory response | 34017102 |
| Gene | MAP3K7 | GO:0007249 | canonical NF-kappaB signal transduction | 10882101|19675569|34871740|35952808 |
| Gene | MAP3K7 | GO:0007252 | I-kappaB phosphorylation | 11460167 |
| Gene | MAP3K7 | GO:0007254 | JNK cascade | 9079627 |
| Gene | MAP3K7 | GO:0034142 | toll-like receptor 4 signaling pathway | 25371197 |
| Gene | MAP3K7 | GO:0038066 | p38MAPK cascade | 11460167 |
| Gene | MAP3K7 | GO:0038172 | interleukin-33-mediated signaling pathway | 20532808 |
| Gene | MAP3K7 | GO:0038173 | interleukin-17A-mediated signaling pathway | 31376257 |
| Gene | MAP3K7 | GO:0042742 | defense response to bacterium | 11460167 |
| Gene | MAP3K7 | GO:0043123 | positive regulation of canonical NF-kappaB signal transduction | 11460167 |
| Gene | MAP3K7 | GO:0043507 | positive regulation of JUN kinase activity | 11460167 |
| Gene | MAP3K7 | GO:0051403 | stress-activated MAPK cascade | 9079627 |
| Gene | MAP3K7 | GO:0097110 | scaffold protein binding | 23776175 |
| Gene | MAP3K7 | GO:0140672 | ATAC complex | 18838386 |
| Gene | MAP3K7 | GO:1990450 | linear polyubiquitin binding | 35952808 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| O43318-1 | O43318-1_2eva_A.pdb | 2EVA | X-ray | 2.0 | A | 31 | 303 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| O43318 | MAP3K7 | O43318-1 | O43318-2 | 606 | 579 | 404 | 430 | Deletion | none | none | 403 | 403 |
| O43318 | MAP3K7 | O43318-1 | O43318-3 | 606 | 518 | 509 | 518 | Substitution | PLAPCPNSKE | ARTSCRTGPG | 509 | 518 |
| O43318 | MAP3K7 | O43318-1 | O43318-3 | 606 | 518 | 519 | 606 | Deletion | none | none | 518 | 518 |
| O43318 | MAP3K7 | O43318-1 | O43318-4 | 606 | 491 | 404 | 430 | Deletion | none | none | 403 | 403 |
| O43318 | MAP3K7 | O43318-1 | O43318-4 | 606 | 491 | 509 | 518 | Substitution | PLAPCPNSKE | ARTSCRTGPG | 482 | 491 |
| O43318 | MAP3K7 | O43318-1 | O43318-4 | 606 | 491 | 519 | 606 | Deletion | none | none | 491 | 491 |
Multiple sequence alignment of our canonical and alternatively spliced MAP3K7 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of MAP3K7 |
| UniProt-id | ENSG | ENST | ENSP |
| O43318-1 | ENSG00000135341.19 | ENST00000369329.8 | ENSP00000358335.3 |
| O43318-2 | ENSG00000135341.19 | ENST00000369332.7 | ENSP00000358338.3 |
| O43318-2 | ENSG00000135341.19 | ENST00000700580.1 | ENSP00000515074.1 |
| O43318-3 | ENSG00000135341.19 | ENST00000369325.7 | ENSP00000358331.3 |
| O43318-4 | ENSG00000135341.19 | ENST00000369327.7 | ENSP00000358333.3 |
| UniProt-id | NM ID | NP ID |
| O43318-1 | NM_145331.2 | NP_663304.1 |
| O43318-2 | NM_003188.3 | NP_003179.1 |
| O43318-3 | NM_145332.2 | NP_663305.1 |
| O43318-4 | NM_145333.2 | NP_663306.1 |
Amino acid sequences of our canonical and alternatively spliced MAP3K7 |
| accession_id | Protein sequence |
| O43318-1 | MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIV KLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEP GQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI |
| O43318-2 | MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIV KLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTR SHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL |
| O43318-3 | MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIV KLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEP |
| O43318-4 | MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIV KLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTR |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| MAP3K7 (go to UniProt):O43318 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Gene Isoform Structures and Expression Levels for MAP3K7 |
Gene structures of our canonical and alternative spliced genes of MAP3K7* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of O43318-1 |
| 3D view using mol* of O43318-2 |
| 3D view using mol* of O43318-3 |
| 3D view using mol* of O43318-4 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of O43318-1 |
![]() |
| Ramachandran plot of O43318-3 |
![]() |
| Ramachandran plot of O43318-4 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| O43318-1 | 1.15 | 76 | 1.227 | 163.268 | 0.309 | 0.86 | 1.205 | 4.162 | 0.333 | 12.499 | 1.809 | 186,201,202,237,240,241,244,497,499,502,531,534,53 5,538 |
| O43318-2 | 1.068 | 125 | 1.084 | 379.015 | 0.508 | 0.792 | 1.023 | 1.093 | 1.017 | 1.074 | 1.043 | 42,43,45,46,47,50,61,63,77,81,90,104,105,106,107,1 10,111,114,156,158,160,161,163,174,175,176,178,185 ,188,189,190,191,192 |
| O43318-3 | 1.044 | 142 | 1.03 | 387.933 | 0.555 | 0.764 | 0.982 | 0.464 | 1.131 | 0.41 | 0.912 | 42,43,44,45,46,47,50,61,63,77,81,90,104,105,106,10 7,110,111,114,154,156,158,160,161,163,174,175,176, 177,178,179,180,181,184,185,188,189,190,191 |
| O43318-4 | 1.082 | 108 | 1.131 | 271.313 | 0.534 | 0.75 | 0.949 | 1.055 | 0.796 | 1.326 | 0.528 | 42,43,44,45,46,50,61,63,77,81,90,104,106,107,110,1 11,114,158,160,161,163,174,175,176 |
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of O43318-1_O43318-1_2eva_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O43318-1_2eva_A_O43318-2.pdb |
| 3D view using mol* of O43318-1_2eva_A_O43318-3.pdb |
| 3D view using mol* of O43318-1_2eva_A_O43318-4.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of O43318-1_O43318-2.pdb |
| 3D view using mol* of O43318-1_O43318-3.pdb |
| 3D view using mol* of O43318-1_O43318-4.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/O43318-1_vs_O43318-2.png |
< |
| ./stats/secondary_structure/figure/O43318-1_vs_O43318-3.png |
< |
| ./stats/secondary_structure/figure/O43318-1_vs_O43318-4.png |
< |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/O43318-1_vs_O43318-2.png |
< |
| ./stats/relative_asa/O43318-1_vs_O43318-3.png |
< |
| ./stats/relative_asa/O43318-1_vs_O43318-4.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to MAP3K7 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to MAP3K7 |
Previous studies relating to the alternative splicing of MAP3K7 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| MAP3K7 | 21822258 | Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). | Interleukin 17 (IL-17) promotes the expression of chemokines and cytokines via the induction of gene transcription and post-transcriptional stabilization of mRNA. We show here that IL-17 enhanced the stability of chemokine CXCL1 mRNA and other mRNAs through a pathway that involved the adaptor Act1, the adaptors TRAF2 or TRAF5 and the splicing factor SF2 (also known as alternative splicing factor (ASF)). TRAF2 and TRAF5 were necessary for IL-17 to signal the stabilization of CXCL1 mRNA. Furthermore, IL-17 promoted the formation of complexes of TRAF5-TRAF2, Act1 and SF2 (ASF). Overexpression of SF2 (ASF) shortened the half-life of CXCL1 mRNA, whereas depletion of SF2 (ASF) prolonged it. SF2 (ASF) bound chemokine mRNA in unstimulated cells, whereas the SF2 (ASF)-mRNA interaction was much lower after stimulation with IL-17. Our findings define an IL-17-induced signaling pathway that links to the stabilization of selected mRNA species through Act1, TRAF2-TRAF5 and the RNA-binding protein SF2 (ASF). | D007249 | Inflammation |
Clinically important variants in MAP3K7 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
|
|