Protein:TAP2 |
Protein Summary |
 Gene summary |
| Gene name: TAP2 | ASpdb.0 ID: 6891 | Gene | Gene symbol | TAP2 | Gene ID | 6891 |
| Gene name | transporter 2, ATP binding cassette subfamily B member |
| Synonyms | ABC18|ABCB3|APT2|D6S217E|PSF-2|PSF2|RING11 |
| Cytomap | 6p21.32 |
| Type of gene | protein-coding |
| Description | antigen peptide transporter 2ABC transporter, MHC 2ATP-binding cassette, sub-family B (MDR/TAP), member 3peptide supply factor 2peptide transporter PSF2peptide transporter involved in antigen processing 2really interesting new gene 11 proteintransp |
| Modification date | 20240411 |
| UniProtAcc | Q03519 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | TAP2 | GO:0005524 | ATP binding | 7673167 |
| Gene | TAP2 | GO:0005783 | endoplasmic reticulum | 22638925 |
| Gene | TAP2 | GO:0005783 | endoplasmic reticulum | - |
| Gene | TAP2 | GO:0005789 | endoplasmic reticulum membrane | 7673167|22638925 |
| Gene | TAP2 | GO:0015433 | ABC-type peptide antigen transporter activity | 25377891 |
| Gene | TAP2 | GO:0016020 | membrane | 8955196 |
| Gene | TAP2 | GO:0016607 | nuclear speck | - |
| Gene | TAP2 | GO:0019885 | antigen processing and presentation of endogenous peptide antigen via MHC class I | 8496691 |
| Gene | TAP2 | GO:0042605 | peptide antigen binding | 7500034 |
| Gene | TAP2 | GO:0042824 | MHC class I peptide loading complex | 17947644 |
| Gene | TAP2 | GO:0042825 | TAP complex | 15518576|17947644 |
| Gene | TAP2 | GO:0046968 | peptide antigen transport | 8496691 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q03519-1 | Q03519-1_5u1d_B.pdb | 5U1D | EM | 3.97 | B | 130 | 681 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q03519 | TAP2 | Q03519-1 | Q03519-2 | 686 | 653 | 645 | 686 | Substitution | LQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL | KTLWKFMIF | 645 | 653 |
| Multiple sequence alignment of our canonical and alternatively spliced TAP2 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of TAP2 |
| UniProt-id | ENSG | ENST | ENSP |
| Q03519-1 | ENSG00000204267.19 | ENST00000374897.4 | ENSP00000364032.3 |
| Q03519-1 | ENSG00000206235.8 | ENST00000383118.8 | ENSP00000372599.4 |
| Q03519-1 | ENSG00000206299.8 | ENST00000383239.8 | ENSP00000372726.4 |
| Q03519-1 | ENSG00000228582.9 | ENST00000443713.6 | ENSP00000394101.2 |
| Q03519-1 | ENSG00000204267.19 | ENST00000698440.1 | ENSP00000513722.1 |
| Q03519-1 | ENSG00000204267.19 | ENST00000698448.1 | ENSP00000513733.1 |
| Q03519-2 | ENSG00000206235.8 | ENST00000383119.8 | ENSP00000372600.4 |
| Q03519-2 | ENSG00000206299.8 | ENST00000383240.8 | ENSP00000372727.4 |
| Q03519-2 | ENSG00000228582.9 | ENST00000414145.6 | ENSP00000401377.2 |
| Q03519-2 | ENSG00000232326.9 | ENST00000426977.2 | ENSP00000387553.2 |
| Q03519-2 | ENSG00000225967.9 | ENST00000439425.6 | ENSP00000396156.2 |
| Q03519-2 | ENSG00000223481.9 | ENST00000451907.2 | ENSP00000392172.2 |
| Q03519-2 | ENSG00000204267.19 | ENST00000652259.1 | ENSP00000498827.1 |
| UniProt-id | NM ID | NP ID |
| Q03519-1 | NM_001290043.1 | NP_001276972.1 |
| Q03519-2 | NM_018833.2 | NP_061313.2 |
| Amino acid sequences of our canonical and alternatively spliced TAP2 |
| accession_id | Protein sequence |
| Q03519-1 | MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAP PARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANV LLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQ PNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL |
| Q03519-2 | MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAP PARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANV LLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQ PNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| TAP2 (go to UniProt):Q03519 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q03519 | Topological domain | 430 | 686 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=645;End=686 |
| Q03519 | Domain | 468 | 686 | Note=ABC transporter;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00434 | Type=Substitution;Start=645;End=686 |
Gene Isoform Structures and Expression Levels for TAP2 |
| Gene structures of our canonical and alternative spliced genes of TAP2 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q03519-1 |
| 3D view using mol* of Q03519-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q03519-1 |
 |
| pLDDT distribution across the protein length of Q03519-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q03519-1 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q03519-1 | 1.074 | 78 | 1.077 | 116.62 | 0.366 | 0.891 | 1.172 | 2.171 | 0.883 | 2.457 | 0.382 | 498,500,628,630,634,642,645,646,648,649,656,658,66 4,665,668,669,670 |
| Q03519-2 | 1.018 | 83 | 1.052 | 151.606 | 0.549 | 0.744 | 0.966 | 1.791 | 0.769 | 2.327 | 1.725 | 470,491,493,499,500,501,502,505,509,510,512,513,51 6,629,630,631,632,634,652,653 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q03519-1_Q03519-1_5u1d_B.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q03519-1_5u1d_B_Q03519-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q03519-1_Q03519-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q03519-1_vs_Q03519-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q03519-1_vs_Q03519-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to TAP2 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to TAP2 |
| Previous studies relating to the alternative splicing of TAP2 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| TAP2 | 17192492 | Genetic control of alternative splicing in the TAP2 gene: possible implication in the genetics of type 1 diabetes. | The transporter 2, ATP-binding cassette, subfamily B (TAP2) is involved in the transport of antigenic peptides to HLA molecules. Coding TAP2 polymorphisms shows a strong association with type 1 diabetes, but it is not clear whether this association may be entirely due to linkage disequilibrium with HLA DR and DQ. Functionally, rat Tap2 nonsynonymous single-nucleotide polymorphisms (nsSNPs) confer differential selectivity for antigenic peptides, but this was not shown to be the case for human TAP2 nsSNPs. In the human, differential peptide selectivity is rather conferred by two splicing isoforms with alternative carboxy terminals. Here, we tested the hypothesis that alleles at the coding SNPs favor different splicing isoforms, thus determining peptide selectivity indirectly. This may be the basis for independent contribution to the type 1 diabetes association. In RNA from heterozygous lymphoblastoid lines, we measured the relative abundance of each SNP haplotype in each isoform. In isoform NM_000544, the G (Ala) allele at 665 Thr>Ala (rs241447) is more than twice as abundant as A (Thr) (GA = 2.2 +/- 0.4, P = 1.5 x 10(-4)), while isoform NM_018833 is derived almost exclusively from chromosomes carrying A (AG = 18.1 +/- 5.6, P = 2.04 x 10(-7)). In 889 Canadian children with type 1 diabetes, differential transmission of parental TAP2 alleles persisted (P = 0.011) when analysis was confined to chromosomes carrying only DQ*02 alleles, which mark a conserved DR-DQ haplotype, thus eliminating most of the variation at DR-DQ. Thus, we present evidence of TAP2 association with type 1 diabetes that is independent of HLA DR-DQ and describe a plausible functional mechanism based on allele dependence of splicing into isoforms known to have differential peptide selectivities. | D003922 | Diabetes Mellitus, Type 1 |
Clinically important variants in TAP2 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |