Protein:TGIF1 |
Protein Summary |
 Gene summary |
| Gene name: TGIF1 | ASpdb.0 ID: 7050 | Gene | Gene symbol | TGIF1 | Gene ID | 7050 |
| Gene name | TGFB induced factor homeobox 1 |
| Synonyms | HPE4|TGIF |
| Cytomap | 18p11.31 |
| Type of gene | protein-coding |
| Description | homeobox protein TGIF15'-TG-3'-interacting factor 1TALE homeobox TG-interacting factortransforming growth factor-beta-induced factor |
| Modification date | 20240411 |
| UniProtAcc | Q15583 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | TGIF1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 10764806 |
| Gene | TGIF1 | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding | 10764806 |
| Gene | TGIF1 | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific | 10764806 |
| Gene | TGIF1 | GO:0005654 | nucleoplasm | - |
| Gene | TGIF1 | GO:1990837 | sequence-specific double-stranded DNA binding | 28473536 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q15583-1 | Q15583-1_6fqp_A.pdb | 6FQP | X-ray | 2.42 | A | 168 | 234 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q15583 | TGIF1 | Q15583-1 | Q15583-2 | 401 | 272 | 1 | 129 | Deletion | none | none | 0 | 0 |
| Q15583 | TGIF1 | Q15583-1 | Q15583-2 | 401 | 272 | 130 | 133 | Substitution | LETM | MKGK | 1 | 4 |
| Q15583 | TGIF1 | Q15583-1 | Q15583-3 | 401 | 286 | 1 | 115 | Deletion | none | none | 0 | 0 |
| Q15583 | TGIF1 | Q15583-1 | Q15583-3 | 401 | 286 | 116 | 134 | Substitution | PSQGAQGPAPRRRLLETMK | MTCSGKSCALARSSLTSSQ | 1 | 19 |
| Q15583 | TGIF1 | Q15583-1 | Q15583-4 | 401 | 252 | 1 | 149 | Deletion | none | none | 0 | 0 |
| Multiple sequence alignment of our canonical and alternatively spliced TGIF1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of TGIF1 |
| UniProt-id | ENSG | ENST | ENSP |
| Q15583-2 | ENSG00000177426.22 | ENST00000343820.10 | ENSP00000339631.6 |
| Q15583-2 | ENSG00000177426.22 | ENST00000407501.6 | ENSP00000384133.2 |
| Q15583-3 | ENSG00000177426.22 | ENST00000618001.4 | ENSP00000483499.1 |
| Q15583-4 | ENSG00000177426.22 | ENST00000330513.10 | ENSP00000327959.6 |
| Q15583-4 | ENSG00000177426.22 | ENST00000345133.9 | ENSP00000343969.5 |
| Q15583-4 | ENSG00000177426.22 | ENST00000400167.6 | ENSP00000383031.2 |
| Q15583-4 | ENSG00000177426.22 | ENST00000401449.5 | ENSP00000385206.1 |
| Q15583-4 | ENSG00000177426.22 | ENST00000405385.7 | ENSP00000384970.2 |
| Q15583-4 | ENSG00000177426.22 | ENST00000472042.1 | ENSP00000449501.1 |
| Q15583-4 | ENSG00000177426.22 | ENST00000548489.6 | ENSP00000447747.2 |
| Q15583-4 | ENSG00000177426.22 | ENST00000551541.5 | ENSP00000450025.1 |
| UniProt-id | NM ID | NP ID |
| Q15583-2 | NM_001278684.1 | NP_001265613.1 |
| Q15583-2 | NM_003244.3 | NP_003235.1 |
| Q15583-2 | NM_173208.2 | NP_775300.1 |
| Q15583-3 | NM_173207.2 | NP_775299.1 |
| Q15583-4 | NM_001278686.1 | NP_001265615.1 |
| Q15583-4 | NM_170695.3 | NP_733796.2 |
| Q15583-4 | NM_173209.2 | NP_775301.1 |
| Q15583-4 | NM_173210.2 | NP_775302.1 |
| Q15583-4 | NM_173211.1 | NP_775303.1 |
| Q15583-4 | NM_174886.2 | NP_777480.1 |
| Amino acid sequences of our canonical and alternatively spliced TGIF1 |
| accession_id | Protein sequence |
| Q15583-1 | MVLAQSRVSAGVGSPHCSGSGGGGSDSFPWPASHPGNPQCSFSTAFLASPRLSRGTLAYLPPAPWSSLATPSALLGSSCAPPPPPARCPQ PRALSPELGTKAGPRRPHRWELPRSPSQGAQGPAPRRRLLETMKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILR DWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPF HSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSG |
| Q15583-2 | MKGKKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINAR RRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTA LKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKL |
| Q15583-3 | MTCSGKSCALARSSLTSSQGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTH LSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSV LARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDV |
| Q15583-4 | MDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTI SRRGAKISETSSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDI |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| TGIF1 (go to UniProt):Q15583 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q15583 | Region | 1 | 34 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=129 |
| Q15583 | Region | 1 | 34 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=115 |
| Q15583 | Region | 1 | 34 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=149 |
| Q15583 | Region | 78 | 127 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=129 |
| Q15583 | Region | 78 | 127 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=115 |
| Q15583 | Region | 78 | 127 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Substitution;Start=116;End=134 |
| Q15583 | Region | 78 | 127 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=149 |
| Q15583 | Region | 139 | 170 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=149 |
Gene Isoform Structures and Expression Levels for TGIF1 |
| Gene structures of our canonical and alternative spliced genes of TGIF1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q15583-1 |
| 3D view using mol* of Q15583-2 |
| 3D view using mol* of Q15583-3 |
| 3D view using mol* of Q15583-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q15583-1 |
 |
| pLDDT distribution across the protein length of Q15583-2 |
 |
| pLDDT distribution across the protein length of Q15583-3 |
 |
| pLDDT distribution across the protein length of Q15583-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q15583-1 |
 |
| Ramachandran plot of Q15583-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q15583-1 | 0.714 | 48 | 0.675 | 142.345 | 0.655 | 0.608 | 0.825 | 0.35 | 1.045 | 0.335 | 0.354 | 168,169,170,171,176,180,210,213,214,217,218,221,22 2 |
| Q15583-2 | 0.755 | 50 | 0.755 | 134.113 | 0.679 | 0.58 | 0.714 | 0.541 | 0.79 | 0.685 | 0.313 | 39,40,41,42,47,51,81,84,85,88,89,92,93
|
| Q15583-3 | 0.72 | 49 | 0.687 | 135.142 | 0.66 | 0.602 | 0.778 | 0.529 | 1.018 | 0.519 | 0.228 | 53,54,55,56,61,65,95,98,99,102,103,106,107
|
| Q15583-4 | 0.654 | 28 | 0.647 | 119.364 | 0.788 | 0.564 | 0.684 | 0.811 | 0.581 | 1.395 | 0.238 | 21,22,27,31,61,64,65,68,69,72,73
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q15583-1_Q15583-1_6fqp_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q15583-1_6fqp_A_Q15583-2.pdb |
| 3D view using mol* of Q15583-1_6fqp_A_Q15583-3.pdb |
| 3D view using mol* of Q15583-1_6fqp_A_Q15583-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q15583-1_Q15583-2.pdb |
| 3D view using mol* of Q15583-1_Q15583-3.pdb |
| 3D view using mol* of Q15583-1_Q15583-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q15583-1_vs_Q15583-2.png |
 < |
| ./stats/secondary_structure/figure/Q15583-1_vs_Q15583-3.png |
 < |
| ./stats/secondary_structure/figure/Q15583-1_vs_Q15583-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q15583-1_vs_Q15583-2.png |
 < |
| ./stats/relative_asa/Q15583-1_vs_Q15583-3.png |
 < |
| ./stats/relative_asa/Q15583-1_vs_Q15583-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to TGIF1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to TGIF1 |
| Previous studies relating to the alternative splicing of TGIF1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| TGIF1 | 18455519 | Genomic structure, alternative splicing and expression of TG-interacting factor, in human myeloid leukemia blasts and cell lines. | TG-interacting factor (TGIF) is a homeobox transcriptional repressor that has been implicated in holoprosencephaly and various types of cancer, including leukemias. In this study, we provide the first detailed description of the TGIF locus characterizing 12 TGIF splice isoforms. These isoforms have similar open reading frames but different 5' untranslated regions. TGIF expression data are presented from multiple tissues, cell lines and primary leukemia cells. Isoform-specific real-time PCR analysis showed that even though these isoforms were broadly expressed all except isoform 4, had very low level of expression. In fact, isoform 4 was the predominant TGIF isoform expressed in all tissues analyzed. Since TGIF, levels have recently implicated to play a role in acute myelogenous leukemia we proceeded to characterize the minimal promoter region of isoform 4 as a first step in understanding mechanisms of TGIF expression. As expected for homeobox genes, the minimal promoter region for isoform 4 has multiple Sp1 binding sites and a CpG island raising the possibility that the low TGIF expression seen in some AML patients and leukemia cell lines may be secondary to methylation. Further characterization of expression from this promoter using 5-Aza-2'-deoxycytidine treatment and transient expression assays showed that decreased TGIF expression is likely secondary to active repression and not because of promoter methylation. A detailed characterization of this complex locus is important as it may help to clarify the functions of this gene in brain development and leukemia biology. | D015470 | Leukemia, Myeloid, Acute |
Clinically important variants in TGIF1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |