Protein:TIE1 |
Protein Summary |
 Gene summary |
| Gene name: TIE1 | ASpdb.0 ID: 7075 | Gene | Gene symbol | TIE1 | Gene ID | 7075 |
| Gene name | tyrosine kinase with immunoglobulin like and EGF like domains 1 |
| Synonyms | JTK14|LMPHM11|TIE |
| Cytomap | 1p34.2 |
| Type of gene | protein-coding |
| Description | tyrosine-protein kinase receptor Tie-1tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1 |
| Modification date | 20240411 |
| UniProtAcc | P35590 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P35590-1 | P35590-1_5n06_A.pdb | 5N06 | X-ray | 2.5 | A | 643 | 738 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P35590 | TIE1 | P35590-1 | P35590-2 | 1138 | 379 | 348 | 379 | Substitution | DRIPQILNMASELEFNLETMPRINCAAAGNPF | GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG | 348 | 379 |
| P35590 | TIE1 | P35590-1 | P35590-2 | 1138 | 379 | 380 | 1138 | Deletion | none | none | 379 | 379 |
| P35590 | TIE1 | P35590-1 | P35590-3 | 1138 | 317 | 305 | 317 | Substitution | ACAPGHFGADCRL | VHQGHCGAREDHS | 305 | 317 |
| P35590 | TIE1 | P35590-1 | P35590-3 | 1138 | 317 | 318 | 1138 | Deletion | none | none | 317 | 317 |
| Multiple sequence alignment of our canonical and alternatively spliced TIE1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of TIE1 |
| UniProt-id | ENSG | ENST | ENSP |
| P35590-1 | ENSG00000066056.14 | ENST00000372476.8 | ENSP00000361554.3 |
| P35590-2 | ENSG00000066056.14 | ENST00000538015.1 | ENSP00000440063.1 |
| UniProt-id | NM ID | NP ID |
| P35590-1 | NM_005424.4 | NP_005415.1 |
| Amino acid sequences of our canonical and alternatively spliced TIE1 |
| accession_id | Protein sequence |
| P35590-1 | MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTL RGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQE QCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPL AAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT DCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGP ASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRA SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQ FSSGTLTLTRRPKLQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGEN LASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD |
| P35590-2 | MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTL RGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQE QCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSGWRDWVDTSTEKQ |
| P35590-3 | MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTL RGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQE |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| TIE1 (go to UniProt):P35590 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P35590 | Topological domain | 22 | 759 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=348;End=379 |
| P35590 | Topological domain | 22 | 759 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=380;End=1138 |
| P35590 | Topological domain | 22 | 759 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=305;End=317 |
| P35590 | Topological domain | 22 | 759 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=318;End=1138 |
| P35590 | Transmembrane | 760 | 784 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=380;End=1138 |
| P35590 | Transmembrane | 760 | 784 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=318;End=1138 |
| P35590 | Topological domain | 785 | 1138 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=380;End=1138 |
| P35590 | Topological domain | 785 | 1138 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 305 | 345 | Note=EGF-like 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00076 | Type=Substitution;Start=305;End=317 |
| P35590 | Domain | 305 | 345 | Note=EGF-like 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00076 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 372 | 426 | Note=Ig-like C2-type 2 | Type=Substitution;Start=348;End=379 |
| P35590 | Domain | 372 | 426 | Note=Ig-like C2-type 2 | Type=Deletion;Start=380;End=1138 |
| P35590 | Domain | 372 | 426 | Note=Ig-like C2-type 2 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 446 | 545 | Note=Fibronectin type-III 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=380;End=1138 |
| P35590 | Domain | 446 | 545 | Note=Fibronectin type-III 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 548 | 642 | Note=Fibronectin type-III 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=380;End=1138 |
| P35590 | Domain | 548 | 642 | Note=Fibronectin type-III 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 646 | 739 | Note=Fibronectin type-III 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=380;End=1138 |
| P35590 | Domain | 646 | 739 | Note=Fibronectin type-III 3;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00316 | Type=Deletion;Start=318;End=1138 |
| P35590 | Domain | 839 | 1118 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Deletion;Start=380;End=1138 |
| P35590 | Domain | 839 | 1118 | Note=Protein kinase;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00159 | Type=Deletion;Start=318;End=1138 |
Gene Isoform Structures and Expression Levels for TIE1 |
| Gene structures of our canonical and alternative spliced genes of TIE1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P35590-1 |
| 3D view using mol* of P35590-2 |
| 3D view using mol* of P35590-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of P35590-1 |
 |
| pLDDT distribution across the protein length of P35590-2 |
 |
| pLDDT distribution across the protein length of P35590-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P35590-1 |
 |
| Ramachandran plot of P35590-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P35590-1 | 1.061 | 228 | 1.076 | 336.14 | 0.367 | 0.785 | 1.028 | 0.721 | 1.029 | 0.701 | 1.045 | 30,31,32,33,34,39,118,119,120,121,122,123,128,129, 130,131,132,133,147,282,291,292,293,298,299,300,30 1,302,303,314,316 |
| P35590-2 | 1.061 | 220 | 1.074 | 368.039 | 0.359 | 0.789 | 1.053 | 0.851 | 1.042 | 0.816 | 1.129 | 31,33,34,39,99,118,119,120,121,123,128,129,130,131 ,132,133,147,149,282,291,292,293,298,299,300,301,3 02,314,315,316 |
| P35590-3 | 1.039 | 239 | 1.061 | 556.689 | 0.494 | 0.742 | 0.977 | 0.7 | 0.993 | 0.705 | 1.168 | 31,33,34,39,96,99,118,119,120,121,122,123,128,129, 130,131,132,133,134,135,147,233,247,248,250,282,28 9,290,291,292,293,294,295,296,297,298,299,300,301, 302,306,310 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P35590-1_P35590-1_5n06_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P35590-1_5n06_A_P35590-2.pdb |
| 3D view using mol* of P35590-1_5n06_A_P35590-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P35590-1_P35590-2.pdb |
| 3D view using mol* of P35590-1_P35590-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/P35590-1_vs_P35590-2.png |
 < |
| ./stats/secondary_structure/figure/P35590-1_vs_P35590-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P35590-1_vs_P35590-2.png |
 < |
| ./stats/relative_asa/P35590-1_vs_P35590-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to TIE1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P35590 | TIE1 | DB12010 | Fostamatinib | approved, investigational | inhibitor |
Related Diseases to TIE1 |
| Previous studies relating to the alternative splicing of TIE1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| TIE1 | 18593464 | Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. | Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis. | D001172 | Arthritis, Rheumatoid |
| TIE1 | 18593464 | Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. | Despite the advent of biological therapies for the treatment of rheumatoid arthritis, there is a compelling need to develop alternative therapeutic targets for nonresponders to existing treatments. Soluble receptors occur naturally in vivo, such as the splice variant of the cell surface receptor for vascular endothelial growth factor (VEGF)--a key regulator of angiogenesis in rheumatoid arthritis. Bioinformatics analyses predict that the majority of human genes undergo alternative splicing, generating proteins--many of which may have regulatory functions. The objective of the present study was to identify alternative splice variants (ASV) from cell surface receptor genes, and to determine whether the novel proteins encoded exert therapeutic activity in an in vivo model of arthritis. | D004195 | Disease Models, Animal |
Clinically important variants in TIE1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |