Protein:TSG101 |
Protein Summary |
 Gene summary |
| Gene name: TSG101 | ASpdb.0 ID: 7251 | Gene | Gene symbol | TSG101 | Gene ID | 7251 |
| Gene name | tumor susceptibility 101 |
| Synonyms | TSG10|VPS23 |
| Cytomap | 11p15.1 |
| Type of gene | protein-coding |
| Description | tumor susceptibility gene 101 proteinESCRT-I complex subunit TSG101tumor susceptibility gene 10tumor susceptibility gene 101tumor susceptibility protein |
| Modification date | 20240407 |
| UniProtAcc | Q99816 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | TSG101 | GO:0000813 | ESCRT I complex | 18005716|20654576|21757351|22232651 |
| Gene | TSG101 | GO:0005730 | nucleolus | - |
| Gene | TSG101 | GO:0005737 | cytoplasm | 18077552 |
| Gene | TSG101 | GO:0005768 | endosome | 17940959 |
| Gene | TSG101 | GO:0005769 | early endosome | 11916981|17229889 |
| Gene | TSG101 | GO:0005829 | cytosol | - |
| Gene | TSG101 | GO:0005886 | plasma membrane | 17940959 |
| Gene | TSG101 | GO:0043130 | ubiquitin binding | 11595185|11916981|20654576 |
| Gene | TSG101 | GO:0043162 | ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway | 15611048 |
| Gene | TSG101 | GO:0044877 | protein-containing complex binding | 16973552 |
| Gene | TSG101 | GO:0046790 | virion binding | 11595185 |
| Gene | TSG101 | GO:0070062 | extracellular exosome | 15326289|16501490|23092844 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q99816-1 | Q99816-1_4yc1_A.pdb | 4YC1 | X-ray | 2.0 | A | 1 | 145 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q99816 | TSG101 | Q99816-1 | Q99816-2 | 390 | 285 | 15 | 119 | Deletion | none | none | 14 | 14 |
| Multiple sequence alignment of our canonical and alternatively spliced TSG101 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of TSG101 |
| UniProt-id | ENSG | ENST | ENSP |
| Q99816-1 | ENSG00000074319.13 | ENST00000251968.4 | ENSP00000251968.3 |
| UniProt-id | NM ID | NP ID |
| Q99816-1 | NM_006292.3 | NP_006283.1 |
| Amino acid sequences of our canonical and alternatively spliced TSG101 |
| accession_id | Protein sequence |
| Q99816-1 | MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVK PTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKL EEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL |
| Q99816-2 | MAVSESQLKKMVSKPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGP YPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVD KNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRA |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| TSG101 (go to UniProt):Q99816 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q99816 | Domain | 2 | 145 | Note=UEV;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00652 | Type=Deletion;Start=15;End=119 |
Gene Isoform Structures and Expression Levels for TSG101 |
| Gene structures of our canonical and alternative spliced genes of TSG101 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q99816-1 |
| 3D view using mol* of Q99816-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q99816-1 |
 |
| pLDDT distribution across the protein length of Q99816-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q99816-1 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q99816-1 | 0.846 | 53 | 0.82 | 79.919 | 0.418 | 0.737 | 1.041 | 1.351 | 0.942 | 1.434 | 0.26 | 61,63,68,69,70,95,135,139,141,142,143
|
| Q99816-2 | 0.486 | 19 | 0.348 | 37.044 | 0.721 | 0.548 | 0.717 | 0 | 1.198 | 0 | 3.285 | 210,211,213,214,215,221,224,225
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q99816-1_Q99816-1_4yc1_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q99816-1_4yc1_A_Q99816-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q99816-1_Q99816-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q99816-1_vs_Q99816-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q99816-1_vs_Q99816-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to TSG101 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to TSG101 |
| Previous studies relating to the alternative splicing of TSG101 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| TSG101 | 10440698 | Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300. | Functional inactivation of the tsg101 gene in mouse fibroblasts leads to cell transformation and the ability to form metastatic tumors in nude mice. Abnormal TSG101 transcripts with highly-specific deletions in the protein-coding region have been identified in human tumor samples and cancer cell lines, including prostate and breast carcinomas, and have been attributed to alternative splicing of TSG101 mRNA. The function of the TSG101 protein is not known, although its predicted sequence has suggested that it may function as a transcription factor. | D002277 | Carcinoma |
| TSG101 | 10440698 | Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300. | Functional inactivation of the tsg101 gene in mouse fibroblasts leads to cell transformation and the ability to form metastatic tumors in nude mice. Abnormal TSG101 transcripts with highly-specific deletions in the protein-coding region have been identified in human tumor samples and cancer cell lines, including prostate and breast carcinomas, and have been attributed to alternative splicing of TSG101 mRNA. The function of the TSG101 protein is not known, although its predicted sequence has suggested that it may function as a transcription factor. | D002471 | Cell Transformation, Neoplastic |
| TSG101 | 10440698 | Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300. | Functional inactivation of the tsg101 gene in mouse fibroblasts leads to cell transformation and the ability to form metastatic tumors in nude mice. Abnormal TSG101 transcripts with highly-specific deletions in the protein-coding region have been identified in human tumor samples and cancer cell lines, including prostate and breast carcinomas, and have been attributed to alternative splicing of TSG101 mRNA. The function of the TSG101 protein is not known, although its predicted sequence has suggested that it may function as a transcription factor. | D011471 | Prostatic Neoplasms |
Clinically important variants in TSG101 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |