ASpdb: an integrative knowledgebase of human protein isoforms from experimental and AI-predicted structures

Home

Download

Statistics

Examples

Help

Contact

	Protein Summary
	AS Summary
	Protein Functional Features
	Gene Isoform Structures and Expression Levels
	Protein Structures
	pLDDT Score Distribution
	Ramachandran Plot of Protein Structures
	Potential Active Site Information
	Protein Structure and Feature Comparision
	Protein-Protein Interaction
	Related Drugs
	Related Diseases
	Clinically Important Variants

Protein:CAMK2B

Protein Summary

Gene summary

Gene name: CAMK2B
ASpdb.0 ID: 816
	Gene
Gene symbol	CAMK2B
Gene ID	816
Gene name	calcium/calmodulin dependent protein kinase II beta
Synonyms	CAM2\|CAMK2\|CAMKB\|CaMKIIbeta\|MRD54
Cytomap	7p13
Type of gene	protein-coding
Description	calcium/calmodulin-dependent protein kinase type II subunit betaCaM kinase II beta subunitCaM-kinase II beta chaincaMK-II subunit betaproline rich calmodulin-dependent protein kinase
Modification date	20240407
UniProtAcc	Q13554

Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Gene	CAMK2B	GO:0005954	calcium- and calmodulin-dependent protein kinase complex	20668654
Gene	CAMK2B	GO:0009931	calcium-dependent protein serine/threonine kinase activity	31930741
Gene	CAMK2B	GO:0018105	peptidyl-serine phosphorylation	31930741
Gene	CAMK2B	GO:0046777	protein autophosphorylation	18817731

AS Summary

Information of the canonical protein with experimentally identified structure from PDB (2023).

UniProt Acc	File name	PDB ID	Method	Resolution	Chain	Start	End
Q13554-1	Q13554-1_3bhh_A.pdb	3BHH	X-ray	2.4	A	11	301

ASpdb's canonical and alternatively spliced isoform information.

accession_id	gene_name	canonical_id	alternative_id	canonical_length	alternative_length	canonical_start	canonical_end	type	originalSEQ	variationSEQ	alternative_start	alternative_end
Q13554	CAMK2B	Q13554-1	Q13554-2	666	542	410	533	Deletion	none	none	409	409
Q13554	CAMK2B	Q13554-1	Q13554-3	666	503	316	316	Substitution	V	A	316	316
Q13554	CAMK2B	Q13554-1	Q13554-3	666	503	317	340	Deletion	none	none	316	316
Q13554	CAMK2B	Q13554-1	Q13554-3	666	503	379	393	Deletion	none	none	354	354
Q13554	CAMK2B	Q13554-1	Q13554-3	666	503	410	533	Deletion	none	none	370	370
Q13554	CAMK2B	Q13554-1	Q13554-4	666	479	316	316	Substitution	V	A	316	316
Q13554	CAMK2B	Q13554-1	Q13554-4	666	479	317	340	Deletion	none	none	316	316
Q13554	CAMK2B	Q13554-1	Q13554-4	666	479	354	392	Deletion	none	none	329	329
Q13554	CAMK2B	Q13554-1	Q13554-4	666	479	410	533	Deletion	none	none	346	346
Q13554	CAMK2B	Q13554-1	Q13554-5	666	518	316	316	Substitution	V	A	316	316
Q13554	CAMK2B	Q13554-1	Q13554-5	666	518	317	340	Deletion	none	none	316	316
Q13554	CAMK2B	Q13554-1	Q13554-5	666	518	410	533	Deletion	none	none	385	385
Q13554	CAMK2B	Q13554-1	Q13554-6	666	492	354	377	Deletion	none	none	353	353
Q13554	CAMK2B	Q13554-1	Q13554-6	666	492	410	533	Deletion	none	none	385	385
Q13554	CAMK2B	Q13554-1	Q13554-6	666	492	559	584	Deletion	none	none	410	410
Q13554	CAMK2B	Q13554-1	Q13554-7	666	449	316	316	Substitution	V	A	316	316
Q13554	CAMK2B	Q13554-1	Q13554-7	666	449	317	533	Deletion	none	none	316	316
Q13554	CAMK2B	Q13554-1	Q13554-8	666	517	316	340	Deletion	none	none	315	315
Q13554	CAMK2B	Q13554-1	Q13554-8	666	517	410	533	Deletion	none	none	384	384

Multiple sequence alignment of our canonical and alternatively spliced CAMK2B

Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CAMK2B

UniProt-id	ENSG	ENST	ENSP
Q13554-1	ENSG00000058404.21	ENST00000395749.7	ENSP00000379098.2
Q13554-2	ENSG00000058404.21	ENST00000350811.7	ENSP00000326375.5
Q13554-2	ENSG00000058404.21	ENST00000440254.6	ENSP00000397937.2
Q13554-2	ENSG00000058404.21	ENST00000700285.1	ENSP00000514918.1
Q13554-3	ENSG00000058404.21	ENST00000358707.7	ENSP00000351542.3
Q13554-4	ENSG00000058404.21	ENST00000353625.8	ENSP00000326427.5
Q13554-5	ENSG00000058404.21	ENST00000395747.6	ENSP00000379096.2
Q13554-6	ENSG00000058404.21	ENST00000347193.8	ENSP00000326544.6
Q13554-7	ENSG00000058404.21	ENST00000346990.8	ENSP00000326518.5
Q13554-8	ENSG00000058404.21	ENST00000258682.10	ENSP00000258682.6

UniProt-id	NM ID	NP ID
Q13554-1	NM_001220.4	NP_001211.3
Q13554-2	NM_001293170.1	NP_001280099.1
Q13554-2	NM_172078.2	NP_742075.1
Q13554-3	NM_172081.2	NP_742078.1
Q13554-4	NM_172083.2	NP_742080.1
Q13554-5	NM_172079.2	NP_742076.1
Q13554-6	NM_172082.2	NP_742079.1
Q13554-7	NM_172084.2	NP_742081.1
Q13554-8	NM_172080.2	NP_742077.1

Amino acid sequences of our canonical and alternatively spliced CAMK2B

accession_id	Protein sequence
Q13554-1	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVRRGSGAPEAEGPLPCPSPAPFSPLPAPSPRI SDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQG
Q13554-2	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALG NLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
Q13554-3	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALESSDSAN TTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGED
Q13554-4	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADGVKESSDSANTTIEDEDAKARKQEIIKTTEQLIE AVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQS
Q13554-5	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVI HNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPI
Q13554-6	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKEPQTTVI HNPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQ
Q13554-7	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLV
Q13554-8	MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVF DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH NPVDGIKESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIH

Protein Functional Features

Main function of this protein. (from UniProt)

CAMK2B (go to UniProt):Q13554

Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page
* Minus value of BPloci means that the break pointn is located before the CDS.

- Retained protein feature among the 13 regional features.

Accession_id	Subsection	Start	End	Funcitonal feature	Splicing information
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=379;End=393
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=354;End=392
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=354;End=377
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=317;End=533
Q13554	Region	349	534	Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	350	368	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=354;End=392
Q13554	Compositional bias	350	368	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=354;End=377
Q13554	Compositional bias	350	368	Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=317;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=317;End=533
Q13554	Compositional bias	430	446	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=317;End=533
Q13554	Compositional bias	511	530	Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256\|SAM:MobiDB-lite	Type=Deletion;Start=410;End=533

Gene Isoform Structures and Expression Levels for CAMK2B

Gene structures of our canonical and alternative spliced genes of CAMK2B
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Expression levels of gene isoforms across GTEx.

Expression levels of gene isoforms across TCGA.

Protein Structures

PDB and CIF files of the predicted protein structures
* Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format.

3D view using mol* of Q13554-1

3D view using mol* of Q13554-2

3D view using mol* of Q13554-3

3D view using mol* of Q13554-4

3D view using mol* of Q13554-5

3D view using mol* of Q13554-6

3D view using mol* of Q13554-7

3D view using mol* of Q13554-8

pLDDT Score Distribution

pLDDT score distribution of the predicted protein structures from AlphaFold2
* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100.

pLDDT distribution across the protein length of Q13554-1

pLDDT distribution across the protein length of Q13554-2

pLDDT distribution across the protein length of Q13554-3

pLDDT distribution across the protein length of Q13554-4

pLDDT distribution across the protein length of Q13554-5

pLDDT distribution across the protein length of Q13554-6

pLDDT distribution across the protein length of Q13554-7

pLDDT distribution across the protein length of Q13554-8

Ramachandran Plot of Protein Structures

Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide.

Ramachandran plot of Q13554-1

Ramachandran plot of Q13554-2

Ramachandran plot of Q13554-5

Ramachandran plot of Q13554-6

Ramachandran plot of Q13554-7

Ramachandran plot of Q13554-8

Potential Active Site Information

The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite.

UniProt-id	Site score	Size	D score	Volume	Exposure	Enclosure	Contact	Phobic	Philic	Balance	Don/Acc	Residues
Q13554-1	1.121	120	1.163	536.452	0.542	0.812	0.996	1.352	0.809	1.67	0.698	20,23,24,25,26,28,41,43,45,50,54,57,58,60,61,65,74 ,90,92,93,94,96,143,156,157,158,159,160
Q13554-2	1.084	62	1.08	93.296	0.319	0.973	1.263	2.917	0.75	3.888	0.828	421,425,433,445,447,458,459,462,463,466,467,497,51 5,517,531,538,539
Q13554-3	1.068	61	1.05	97.412	0.358	0.981	1.148	2.71	0.837	3.239	1.052	382,386,394,406,408,419,420,423,424,427,428,458,47 6,478,492,499,500
Q13554-4	1.075	168	1.106	347.116	0.533	0.774	0.934	1.172	0.916	1.28	0.828	362,363,370,382,384,396,399,400,403,404,406,407,40 9,410,411,434,436,438,439,440,441,442,446,452,454, 468,475,476,477,478,479
Q13554-5	1.082	266	1.126	1199.471	0.583	0.759	0.93	1.057	0.828	1.277	0.913	20,21,23,24,25,26,28,41,43,45,50,53,54,57,58,60,61 ,65,74,90,91,92,93,94,96,97,138,140,141,143,156,15 7,158,159,160,161,177,178,179,180,202,206,211,212, 214,215,216,217,219,222,290,293,294,297,298,299,30 1,302,303,304,305,306,309,355
Q13554-6	1.055	187	1.104	670.222	0.628	0.714	0.854	0.869	0.811	1.071	1.017	20,22,23,24,25,26,27,28,41,43,44,45,46,49,50,54,57 ,58,61,65,74,85,90,91,92,93,94,96,140,141,143,156, 157,158,159,306,309,310,313
Q13554-7	1.082	256	1.122	971.376	0.564	0.764	0.931	1.195	0.846	1.411	0.852	20,23,24,25,26,28,41,43,45,50,53,54,57,58,60,61,74 ,90,91,93,94,95,96,97,135,138,139,140,141,143,156, 157,158,159,160,171,172,173,175,177,178,179,180,19 1,202,206,212,213,214,215,216,217,218,219,222,294, 297,298,299,301,302,303,305,306,309,310,313
Q13554-8	1.085	324	1.132	1443.344	0.571	0.756	0.93	1.188	0.801	1.483	0.764	20,21,23,24,25,26,28,41,43,45,49,50,51,54,57,58,61 ,74,88,90,91,92,93,94,96,134,136,138,140,141,143,1 56,157,158,159,160,161,177,178,179,180,202,206,210 ,211,212,213,214,215,216,217,218,219,222,290,293,2 94,297,298,299,301,302,303,304,305,306,308,309,312 ,313,316,317,320,353,358,359

Protein Structure and Feature Comparision

Protein Structure Comparision Using Template Modeling Scores (TM-score).

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green)

3D view using mol* of Q13554-1_Q13554-1_3bhh_A.pdb

Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q13554-1_3bhh_A_Q13554-2.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-3.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-4.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-5.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-6.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-7.pdb

3D view using mol* of Q13554-1_3bhh_A_Q13554-8.pdb

Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green)

3D view using mol* of Q13554-1_Q13554-2.pdb

3D view using mol* of Q13554-1_Q13554-3.pdb

3D view using mol* of Q13554-1_Q13554-4.pdb

3D view using mol* of Q13554-1_Q13554-5.pdb

3D view using mol* of Q13554-1_Q13554-6.pdb

3D view using mol* of Q13554-1_Q13554-7.pdb

3D view using mol* of Q13554-1_Q13554-8.pdb

Protein Feature Comparison of the protein sequendary structures among the protiens.

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-2.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-3.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-4.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-5.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-6.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-7.png

./stats/secondary_structure/figure/Q13554-1_vs_Q13554-8.png

Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens.

./stats/relative_asa/Q13554-1_vs_Q13554-2.png

./stats/relative_asa/Q13554-1_vs_Q13554-3.png

./stats/relative_asa/Q13554-1_vs_Q13554-4.png

./stats/relative_asa/Q13554-1_vs_Q13554-5.png

./stats/relative_asa/Q13554-1_vs_Q13554-6.png

./stats/relative_asa/Q13554-1_vs_Q13554-7.png

./stats/relative_asa/Q13554-1_vs_Q13554-8.png

Protein-Protein Interaction

Interactors from UniProt.

Accession_id

Subsection

Start

End

Funcitonal feature

Splicing information

Interactors from STRING.

Gene name

Interactors

Related Drugs to CAMK2B

Drugs targeting this gene/protein.
(DrugBank)

UniProt accession	Gene name	DrugBank ID	Drug name	Drug group	Actions
Q13554	CAMK2B	DB12010	Fostamatinib	approved, investigational	inhibitor
Q13554	CAMK2B	DB07168	[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]-6-(methylamino)pyrimidin-2-yl}amino)phenyl]acetonitrile	experimental

Related Diseases to CAMK2B

Previous studies relating to the alternative splicing of CAMK2B and disease information from the MeSH term (PubMed)

Gene	PMID	Title	Abstract	MeSH ID	MeSH term
CAMK2B	7758473	Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms.	Collagen IV, the major component of basement membranes, is composed of six distinct alpha chains (alpha 1-alpha 6). Atypically among the collagen IV genes, the exons encoding the carboxyl-terminal region of the human alpha 3(IV) chain undergo alternative splicing. This region has been designated as the Goodpasture antigen because of its reactivity in the kidney and lung with the pathogenic autoantibodies causing Goodpasture syndrome. The data presented in this report demonstrate that, in human kidney, the gene region encompassing the Goodpasture antigen generates at least six alternatively spliced transcripts predicting five distinct proteins that differ in their carboxyl-terminus and retain, except in one case, the exon that harbors the characteristic amino-terminus of the antigen. Goodpasture antibodies specifically recognize recombinant proteins representing the antigen and the alternative form that retains the amino-half of the antigen, suggesting that this moiety could be involved in the in vivo binding of the pathogenic antibodies. Furthermore, the sera of control individuals contain autoantibodies against the antigen that can be differentiated from those causing the syndrome based on their specific reactivities, suggesting that the binding of the pathogenic autoantibodies to a specific determinant likely trigger a distinct and unique cascade of events causing the disease.	D019867	Anti-Glomerular Basement Membrane Disease

Clinically important variants in CAMK2B

(ClinVar, 04/20/2024)

accession_id

uniprot_id

gene_name

Type

Variant

Clinical_significance